KEGG   Bacillus subtilis subsp. subtilis 168: BSU29400Help
Entry
BSU29400          CDS       T00010                                 

Gene name
ytlI
Definition
(RefSeq) LysR family transcriptional regulator
  KO
K21960  LysR family transcriptional regulator, regulator of the ytmI operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU29400 (ytlI)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    BSU29400 (ytlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_24 HTH_5
Motif
Other DBs
NCBI-GeneID: 938452
NCBI-ProteinID: NP_390818
Pasteur: BG13877
BSORF: BG13877
UniProt: O35038
Position
3008938..3009864
Genome map
AA seq 308 aa AA seqDB search
MELRSIKTFHTIVKFGSFYKAAEILNYSQPTISMRMKQLEQDLGVLLFERGKSLQLTKAG
KLFYERTGDLLMQYEALKHNLSDLKEEEAGIINIGVSEPTASLIFPEILKDFLMDYPKIT
VNIKVDDANTCSQKLLDGTIDFAVCGEPELILENYYHPFFYDTLNVIVSDQHPLAEKKAV
HLSDLAEERFIFTPANCPIRLQIEQHLHRELGNRYKKMELTSSMSHEYYVRENIGISIFT
STAHSKPFNGTKVIPILNLDITPPIGLLTNQKEVHFDRATKDLIARITKRFQQRSKELEG
TSDKTITG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttggagttacgctcaatcaaaacgtttcatacgattgtaaaatttggaagcttctataaa
gctgcagaaatactcaactactcgcagccgacgatatcgatgcgtatgaagcaattggag
caggatttaggcgtactgctgtttgaaagaggaaaaagcctgcagttgacaaaagcaggg
aagcttttttatgaacgaacaggagatcttttgatgcaatacgaggcgcttaaacacaac
ctctccgacttaaaggaagaagaggcaggcattatcaacataggggtttcagagccaacc
gccagtctgatattccccgagattttaaaggatttcttaatggattacccaaagataacg
gttaatatcaaggttgatgacgccaatacctgcagtcaaaagctcttagacgggacgatt
gattttgcagtctgcggcgagccggagctgattcttgaaaattactaccatccatttttt
tatgacacattaaatgtgattgtatctgatcaacatccgctcgctgagaagaaggctgtc
catttgtctgatttagcagaagagcgcttcatatttacgcccgccaattgccccattcgc
ttacaaattgaacagcatttacatagagaactcgggaatcgctacaaaaaaatggagctc
acaagcagcatgtcacatgaatattacgtacgtgaaaacatcggaatttcaatctttacc
agcaccgcacattctaaaccgttcaacggcactaaagtcattccaattctgaacctggat
atcaccccgcccatagggctgttgacaaatcaaaaagaagttcattttgaccgcgccacg
aaggacttgatcgcccggataaccaaacgttttcagcagcgcagcaaagaattggaagga
acctctgataagaccattacaggataa

DBGET integrated database retrieval system