KEGG   Bacillus subtilis subsp. subtilis 168: BSU29460
Entry
BSU29460          CDS       T00010                                 

Symbol
moaB
Name
(RefSeq) molybdenum cofactor biosynthesis protein B
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Module
bsu_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU29460 (moaB)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU29460 (moaB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     BSU29460 (moaB)
SSDB
Motif
Pfam: MoCF_biosynth Coatomer_WDAD
Other DBs
NCBI-GeneID: 937349
NCBI-ProteinID: NP_390824
Pasteur: BG12618
BSORF: BG12618
UniProt: O34457 A0A6M3ZFG6
Position
complement(3014514..3015026)
AA seq 170 aa
MSVQEHKQEAPDIVRCKVITVSDTRTDETDKSGKLMISFLEEAGHHIAAYEIVKDEKDAL
QRSVLAGCMDEQTDAVLLNGGTGIADRDVTIEAITPLFSKELPGFGEIFRMLSYTEDIGS
AAIMSRATAGVIQHTAVFSTPGSSGAVKLAMNKLIIPELAHVVREIRKDK
NT seq 513 nt   +upstreamnt  +downstreamnt
atgagcgttcaagagcataaacaagaagctcccgatatcgttcggtgcaaagtgattact
gtcagtgacacgaggacagatgaaaccgataaaagcggcaagctgatgatctcattttta
gaagaagccggtcatcatattgccgcatatgaaattgtaaaagacgaaaaggatgctttg
caacggtcagtgcttgcgggctgcatggatgaacagacagacgcggtactcttaaacgga
gggacaggcatagcagatcgggatgtcacaattgaagccataacgccgctgttttcgaaa
gaactgcccggctttggagaaatattcaggatgctgagttatacagaggatatcggctct
gccgcaatcatgtcgagagcaactgccggcgtcattcagcataccgctgttttctcaacg
ccaggctcaagcggcgcagtaaagctggcaatgaataagctgattattcccgaacttgcg
catgtggtcagagaaatcagaaaagacaagtaa

DBGET integrated database retrieval system