KEGG   Bacillus subtilis subsp. subtilis 168: BSU29480
Entry
BSU29480          CDS       T00010                                 

Symbol
ytxK
Name
(RefSeq) hypothetical protein
  KO
K00571  site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU29480 (ytxK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     BSU29480 (ytxK)
Prokaryotic defense system [BR:bsu02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    BSU29480 (ytxK)
SSDB
Motif
Pfam: N6_Mtase Methyltransf_31 Methyltransf_25 MTS Ubie_methyltran DOT1 AviRa Methyltransf_32
Other DBs
NCBI-GeneID: 938186
NCBI-ProteinID: NP_390826
Pasteur: BG10812
BSORF: BG10812
UniProt: P37876 A0A6M3ZF94
Position
complement(3016646..3017635)
AA seq 329 aa
MQKDHVGAVYELLNEAAIMIKNELQISYIEALAEAGEMYFLEKTDQLKLPADQKTKQLQA
LLEKAEFGTYEHEWVRKAFQLAVLKGMKDISHPNRQMTPDTIGLFISYLVNKFMADKKEL
TILDPALGTGNLLFTVLNQLSEKTANSFGIEIDDVLLKIAYAQANLLKKELELFHQDSLE
PLFIDPVDTVICDLPVGYYPNDEGAEAFELKADEGHSFAHHLFIEQSVKHTKPGGYLFFM
IPNHLFESSQSGKLKQFFKDKVHINALLQLPKSIFKDEAHAKSILVLQKQGENTKAPGQI
LLANLPSFSNQKAMLDMMAQFDEWFKKEK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcaaaaagaccatgtaggtgcggtgtatgagctgttaaacgaagccgcgattatgata
aagaatgaattgcagatttcatatatagaggcgctggccgaagcaggagaaatgtatttt
cttgaaaaaacggatcagctgaaactgcctgctgatcagaaaaccaaacaacttcaggct
ctgcttgaaaaagcggaattcggcacgtatgagcatgagtgggtacgcaaggcttttcag
cttgccgtccttaaaggaatgaaagatatctcgcatccaaacagacaaatgacgccggat
acgatcgggcttttcatcagctatttggtgaataaatttatggcggacaaaaaggaactg
accattcttgatccagccctgggaactgggaaccttctgtttaccgtgctgaaccagctg
tctgaaaaaacggcaaacagctttggcattgaaattgatgatgtgctcttgaagatcgcc
tatgcccaagcgaaccttctgaaaaaagagcttgagcttttccaccaggacagccttgag
ccgttgtttatcgatccagttgacacggtcatttgtgatctgccagtcggctattatccg
aatgacgaaggagcagaagcgtttgagctcaaagctgacgaaggccattccttcgctcat
catctgtttattgaacagagcgtcaagcataccaaaccgggcggctacttattttttatg
attccgaatcatttgtttgagagctcccaaagcggcaagctgaaacagtttttcaaagat
aaggttcatatcaacgcactgttgcagctgccaaaatctatttttaaagacgaagctcat
gccaaaagcatccttgtgcttcagaaacaaggagagaatacgaaagcgccggggcaaatt
ctgcttgcgaatcttccgtctttctccaatcaaaaggcgatgcttgatatgatggctcaa
tttgatgaatggtttaaaaaagaaaagtaa

DBGET integrated database retrieval system