KEGG   Bacillus subtilis subsp. subtilis 168: BSU29490
Entry
BSU29490          CDS       T00010                                 

Gene name
tpx
Definition
(RefSeq) 2-Cys peroxiredoxin
  KO
K11065  thioredoxin-dependent peroxiredoxin [EC:1.11.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU29490 (tpx)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     BSU29490 (tpx)
Motif
Pfam: Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 937688
NCBI-ProteinID: NP_390827
Pasteur: BG13855
BSORF: BG13855
UniProt: P80864 A0A6M3ZF80
Structure
PDB: 
2JSY 2JSZ

Position
complement(3017696..3018199)
AA seq 167 aa
MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVC
DAQTRRFNEEAAKLGDVNVYTISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVY
IKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIEAAKALVK
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctgaaattacattcaaaggcggtccggttacacttgtcggacaagaagtgaaggta
ggagatcaagctcctgatttcacagtgctgactaacagccttgaagaaaaatcgttagct
gacatgaaaggaaaggtaacgattatttctgttatcccttcaattgatacaggtgtttgt
gatgcacaaacacgccgttttaacgaagaagctgcaaagcttggagatgtcaacgtctac
acaatcagtgcagaccttccattcgcgcaagcgcgctggtgcggcgctaacggaattgac
aaagtggaaacactgtctgaccacagagatatgtcatttggcgaagcgttcggtgtgtat
attaaagaacttcgtctgcttgcgcgttccgtatttgtccttgatgagaacggaaaagtc
gtttacgctgaatatgtaagcgaagcaacaaaccacccgaactatgaaaagccaattgag
gctgctaaggcattagtaaagtaa

DBGET integrated database retrieval system