KEGG   Bacillus subtilis subsp. subtilis 168: BSU29500
Entry
BSU29500          CDS       T00010                                 

Symbol
ytfJ
Name
(RefSeq) spore protein YtfJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Spore_YtfJ DUF2232
Other DBs
NCBI-GeneID: 937346
NCBI-ProteinID: NP_390828
Pasteur: BG13849
BSORF: BG13849
UniProt: O34806 A0A6M3ZIE0
Position
complement(3018309..3018764)
AA seq 151 aa
MADHPIQGLMKTAMENLKEMIDVNTIIGDPVETPDGSVILTVSKVGFGFAAGGSEFGGKP
AEKKSEDDETREQKLPFGGGSGGGVSITPIAFLIVGSTGIRMLHLDENTHLIEKILDAAP
QTLERIQQMFKKNNKNQSQGQNQNQMNNMNY
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcagaccatcccatccaaggtttaatgaaaaccgcaatggaaaacttgaaggaaatg
attgatgttaacaccatcatcggagatccagtggaaacgcctgatggaagtgtgatttta
actgtttctaaagttggattcggattcgccgcaggcggaagcgagtttggcggaaagccg
gccgaaaagaaatcggaagacgatgagacaagagaacagaaacttcctttcggaggcgga
agcgggggcggtgtgtccattacgccgatcgcgtttttaattgtcggatcgacaggcatc
agaatgcttcatttagatgaaaatacccatttaatagagaaaattttagacgcagcccct
caaacactcgagcgcatccagcaaatgttcaagaaaaataacaaaaaccaaagccaaggc
caaaatcaaaaccaaatgaacaatatgaattattaa

DBGET integrated database retrieval system