KEGG   Bacillus subtilis subsp. subtilis 168: BSU29560Help
Entry
BSU29560          CDS       T00010                                 

Gene name
ytcI
Definition
(RefSeq) acyl--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU29560 (ytcI)
   00620 Pyruvate metabolism
    BSU29560 (ytcI)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU29560 (ytcI)
   00640 Propanoate metabolism
    BSU29560 (ytcI)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU29560 (ytcI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU29560 (ytcI)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSU29560 (ytcI)
Lipid biosynthesis proteins [BR:bsu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSU29560 (ytcI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 937336
NCBI-ProteinID: NP_390834
Pasteur: BG13834
BSORF: BG13834
UniProt: C0SPB0
Position
complement(3023677..3025266)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPVQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLKRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctgtgcaatataatttagtgaatgaaatggaa
aagttcagtgctgctggacaaaaaaccgctcttctttgggaggacgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagcggccttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgctgtttatttggctatcctgaaatcaggaatggttgtcattccgtgctccgaaatg
cttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgctatcgtc
tactccgaatttattggcgctttccgggatgtcagtacggctgacaaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccggg
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgacatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtatggagtccgtttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaatcgctac
aaaatcaatgttttctgctgcactccgacagaataccgcttaatggcgaaggttgaaggc
ttgaaacgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaacagaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccgggaagc
atgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctatacgatcgggcctttcgaggtggaagacgcgcttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcaagccctgatgaaatcagaggctccatcgta
aaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system