KEGG   Bacillus subtilis subsp. subtilis 168: BSU29590
Entry
BSU29590          CDS       T00010                                 

Gene name
iscS
Definition
(RefSeq) cysteine desulfurase IscS 2
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU29590 (iscS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU29590 (iscS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU29590 (iscS)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU29590 (iscS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU29590 (iscS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BSU29590 (iscS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    BSU29590 (iscS)
 Prokaryotic type
    BSU29590 (iscS)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BSU29590 (iscS)
Prokaryotic defense system [BR:bsu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   BSU29590 (iscS)
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-GeneID: 937701
NCBI-ProteinID: NP_390837
Pasteur: BG12632
BSORF: BG12632
UniProt: O34874 A0A6M3ZF90
Position
complement(3026957..3028102)
AA seq 381 aa
MIYLDNSSTTKPYDEVLNVYEQTSSRYFGNPSSLHRYGAETEQLLQAAKNQIKRSLGLKK
YDIVFTSGATEANNAALKGAALSKIKTGKHIIATSIEHPSVTESLEQLKELFGFDITYLS
VNEDGFVSIEDLKAAIRPDTVLVSMMHVNNEVGSVQPIEAAGEVLKEHSNILFHVDYVQG
IYKVPLAIEKAGIDLCSISGHKFHGLKGTGALIVKEGTRLIPLITGGSQQKGIRAGTEHT
AGAVSLAKAINLASADFDTRLDTMTAVKELFMNRLSEIEGVVINTPQMNSAPHIINFSVP
GIKAEVLLHMLEEQDIFVSTTSACSAKEHKPSKVLLEMGKGEQIAGSSIRISLNYSQTSD
VAEPFMNALRPGIKKLREMMR
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatatatttagataatagttcaacgacgaagccttacgatgaagtcttgaacgtatat
gaacagacgagcagccgatactttggcaatccttcatctttgcaccgatatggagccgaa
acggaacagctgcttcaagcagccaaaaatcaaatcaaaaggtccttaggcctaaaaaaa
tatgatattgtatttacgtcaggcgccacagaagccaataatgcggctttaaaaggagcg
gctttgtcaaagataaaaacaggcaaacatatcattgccacttctattgaacatccatcc
gttacggaatcgttagaacagctgaaagagttgttcgggtttgatatcacttatctttct
gtgaatgaagacggatttgtttctattgaagatctaaaagcagccatccgtcccgatacc
gtgcttgtcagcatgatgcatgtgaacaatgaagtcggttccgtgcagccgattgaagcg
gcaggagaagtgctgaaagagcattcgaacattttgtttcacgtcgattatgtgcagggc
atctataaagtgcccttggcaattgaaaaggccggcattgatctatgttcaatttcgggg
cataaatttcacggcctaaaggggacaggcgcacttattgtaaaagaaggaacacgcctt
attccgctcataacgggaggctctcagcaaaaaggcatacgggccggaacagaacatact
gctggtgcggtttcgcttgccaaggccattaatctggcctctgctgattttgacacacgg
cttgacacgatgactgccgtaaaggaattgtttatgaataggctgagtgaaattgagggc
gtcgttatcaacacgcctcaaatgaatagcgcgccgcacattattaatttctctgtaccg
gggattaaagcggaagtgcttttacacatgcttgaggaacaggatatattcgtctccaca
acatcggcttgctcggcaaaagaacataagcccagcaaggttctcttagagatgggcaaa
ggagagcagattgccggaagcagcatcagaatcagtttaaattacagccagacaagcgat
gtggcagaaccgtttatgaacgcgcttcgtcctggcatcaaaaaattaagggaaatgatg
aggtag

DBGET integrated database retrieval system