KEGG   Bacillus subtilis subsp. subtilis 168: BSU29610Help
Entry
BSU29610          CDS       T00010                                 

Gene name
ezrA
Definition
(RefSeq) septation ring formation regulator EzrA
  KO
K06286  septation ring formation regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU29610 (ezrA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    BSU29610 (ezrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EzrA DUF1110 FUSC DUF3452 TMPIT
Motif
Other DBs
NCBI-GeneID: 937337
NCBI-ProteinID: NP_390839
Pasteur: BG13934
BSORF: BG13934
UniProt: O34894
Structure
PDB: 

Position
complement(3029729..3031417)
Genome map
AA seq 562 aa AA seqDB search
MEFVIGLLIVLLALFAAGYFFRKKIYAEIDRLESWKIEILNRSIVEEMSKIKHLKMTGQT
EEFFEKWREEWDEIVTAHMPKVEELLYDAEENADKYRFKKANQVLVHIDDLLTAAESSIE
KILREISDLVTSEEKSREEIEQVRERYSKSRKNLLAYSHLYGELYDSLEKDLDEIWSGIK
QFEEETEGGNYITARKVLLEQDRNLERLQSYIDDVPKLLADCKQTVPGQIAKLKDGYGEM
KEKGYKLEHIQLDKELENLSNQLKRAEHVLMTELDIDEASAILQLIDENIQSVYQQLEGE
VEAGQSVLSKMPELIIAYDKLKEEKEHTKAETELVKESYRLTAGELGKQQAFEKRLDEIG
KLLSSVKDKLDAEHVAYSLLVEEVASIEKQIEEVKKEHAEYRENLQALRKEELQARETLS
NLKKTISETARLLKTSNIPGIPSHIQEMLENAHHHIQETVNQLNELPLNMEEAGAHLKQA
EDIVNRASRESEELVEQVILIEKIIQFGNRFRSQNHILSEQLKEAERRFYAFDYDDSYEI
AAAAVEKAAPGAVEKIKADISA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtcattggattattaattgtactgcttgcgctgtttgcggcaggctacttt
ttcaggaaaaaaatctacgccgaaatcgaccggctggaatcgtggaagattgaaattctg
aatcggtcgatcgtggaagaaatgtctaaaataaaacatttaaaaatgacgggtcagaca
gaagagttctttgagaagtggcgtgaagaatgggatgagattgtcacagcccacatgccg
aaagttgaagagctcctttatgatgccgaggaaaatgcagacaaataccggtttaaaaag
gccaatcaagtgctcgttcatatcgacgacctgctgacagcggctgaatcaagcattgaa
aagattcttcgggaaatcagcgatcttgtcacaagtgaggaaaagagccgtgaagagatt
gaacaggtgagggagcgctattcgaaatctcgaaaaaacctgctggcttacagccacctt
tacggggagctttatgacagccttgaaaaggatctggacgaaatttggagcggcatcaaa
caatttgaagaagaaacagaaggcggaaactatattactgcacgaaaagtactgcttgag
caggaccgcaatcttgaacggcttcagtcatacatagatgatgtgccgaagctgttagct
gactgtaaacagacggtgcccggacagattgcaaagctcaaggatggctatggcgaaatg
aaagaaaaagggtacaagcttgagcatatccagcttgataaggaattagaaaatctgtca
aaccagctgaaacgagcggaacatgtcctgatgactgaactggatattgatgaagcgtcc
gcaatcctgcagctcattgacgaaaatattcaatctgtttatcagcagctggagggcgaa
gttgaagccggtcaatccgtactaagcaaaatgcctgaattgattattgcttacgacaag
cttaaagaagagaaagagcatacgaaagcggaaactgagctggtgaaggaaagctacagg
ctgacagccggtgagctcggcaaacagcaggcttttgaaaagcgccttgatgaaattgga
aagctgctatcatccgttaaagataagcttgatgcagagcatgtcgcctactcactttta
gtagaagaagttgcttcaatagagaagcaaattgaagaagtgaaaaaagagcatgccgag
tatcgtgaaaatctgcaagcgctgagaaaagaagagcttcaggcgagggagacgctcagc
aatttgaaaaaaacaatttctgagacagcaagactgctgaagactagcaacattccaggc
attccgagccatattcaagagatgctggagaacgcgcatcatcatattcaagaaacggtc
aatcaactaaacgaacttccattaaatatggaagaagccggagcccatttgaaacaagca
gaagatatcgtcaacagggcaagccgggaatcagaggaacttgtcgagcaggtcatcctc
attgaaaaaatcattcagttcggaaaccggttcagaagccagaatcatattttatctgaa
cagctgaaagaagcggaaagacgtttttatgcttttgattatgacgactcttatgaaatt
gccgctgccgctgtagaaaaggctgcgccaggtgcagttgaaaaaatcaaagctgacata
tccgcttag

DBGET integrated database retrieval system