KEGG   Bacillus subtilis subsp. subtilis 168: BSU29630
Entry
BSU29630          CDS       T00010                                 

Symbol
yttP
Name
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N G10
Other DBs
NCBI-GeneID: 937327
NCBI-ProteinID: NP_390841
Pasteur: BG13927
BSORF: BG13927
UniProt: O34970 A0A6M3ZK13
Structure
PDB: 
6MJ1

Position
complement(3032417..3033040)
AA seq 207 aa
MKVSTKDKIIESAVMLFNQKGFSGTSVREIAKSADVNVAHISYYFKGKGGLMEHLVSEFY
EGYSKTLETAASNISTQSTQEQLLQLVFDILSYQHNHRQLTRFVYREVTIDSTLIREIMS
TYLMKEKYIFQLIIEEGEKQREYLTLPLPHFILQLKSLLMMPYLQPQYISEVLYMQPHEP
YFYKMYFEEIKIWIRSVFRTGDVALTN
NT seq 624 nt   +upstreamnt  +downstreamnt
atgaaagtaagcaccaaagacaaaattattgaatctgctgtcatgctttttaaccaaaaa
ggattttctggcacgtctgtccgtgaaatcgcaaagtcagctgatgtaaatgttgcgcac
atctcctactattttaaaggcaaaggaggcttgatggaacacttagtttcagagttttac
gaaggctacagcaaaacgcttgaaacagcggcaagcaatatctctactcaaagcacgcag
gaacagcttcttcaattggttttcgatattttatcctatcagcataatcatcgtcaatta
actcgttttgtctaccgggaagtcacaattgactccacattaatcagggaaattatgtcg
acatatctaatgaaggaaaagtatatcttccagctgatcattgaggaaggagaaaaacag
cgtgaatatttaacgctgccgctgcctcattttattctccaattaaaatctctcttgatg
atgccctatctccagcctcaatatatttcagaagtactctacatgcagccgcacgagccg
tatttttataaaatgtattttgaagaaatcaagatttggatcagaagcgtcttccggaca
ggagacgtggcgctcaccaactag

DBGET integrated database retrieval system