KEGG   Bacillus subtilis subsp. subtilis 168: BSU29640
Entry
BSU29640          CDS       T00010                                 

Symbol
ytsP
Name
(RefSeq) hypothetical protein
  KO
K08968  L-methionine (R)-S-oxide reductase [EC:1.8.4.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU29640 (ytsP)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.14  L-methionine (R)-S-oxide reductase
     BSU29640 (ytsP)
SSDB
Motif
Pfam: GAF_2 GAF GAF_3
Other DBs
NCBI-GeneID: 936758
NCBI-ProteinID: NP_390842
Pasteur: BG13923
BSORF: BG13923
UniProt: O34553 A0A6M3ZFQ8
Position
3033167..3033658
AA seq 163 aa
MFHVEKQSGDKEKDYQLLLKQLEAMTEDETDQIANYANASALLYHSLPEVNWAGFYFAKE
EDGQLVLGPFQGLPACVRIPFGRGVCGTAYANGKVERIEDVNAFPGHIACDAASQSEIVL
PIRVDGKIVGVLDIDSPVKNRFDEIDEKYLTQFAETLEKALAQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgttccatgtcgaaaaacaatctggagataaagaaaaagactatcagcttctgctaaaa
cagctcgaagccatgaccgaagacgaaacagaccaaatagctaactatgcaaatgcctca
gcactgctgtatcattcgctgcctgaagtcaactgggcgggtttctattttgccaaagaa
gaggatggacagcttgtgttaggtccgttccaaggcctgccggcatgtgttcggattcct
ttcggcagaggggtttgcggcacagcgtacgcaaacggaaaagtggaacgtattgaggat
gtaaacgcgtttccgggacatatcgcctgcgatgcagcgtctcaatcagaaattgtgctt
ccgattcgtgtagacggaaaaattgtcggcgtcttggacatcgacagcccagtgaaaaac
cgtttcgacgaaattgatgaaaaatacttaactcaatttgccgaaacgctagaaaaagcg
ttagcgcagtaa

DBGET integrated database retrieval system