KEGG   Bacillus subtilis subsp. subtilis 168: BSU29650
Entry
BSU29650          CDS       T00010                                 

Symbol
dgcP
Name
(RefSeq) diguanylate cyclase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GGDEF GAF_2 GAF_3 GAF
Other DBs
NCBI-GeneID: 936255
NCBI-ProteinID: NP_390843
Pasteur: BG13918
BSORF: BG13918
UniProt: O34325 A0A6M3ZF35
Position
complement(3033696..3035435)
AA seq 579 aa
MVEQTKDQLSAFHYHMLDFLLTKSEKVTFTDSFIWLTSAIQTYFSTLCVSLTPSPSDFVT
KLADGEARFSASKINASCYLIEDGSGRRFHLACRQDEEIPEGLPDVVASFLNQSMKQERL
YNKTIYQKKIYKMTELFHSLLDQTDVLKQLLESLTSTFSLFEFSLFISHDQDQCLGIPAK
ELYMEGEKSDSFALKVYLSGDILRKNESVAYIPIKGQQGTYGVLKAEGTGDSFLTDACLD
EMSLLANAAGKAFENAQLYEQSKASIANLELINETSRRLNQRLTLTDTMNDLAVRMAESF
QAEEVGFFHIDHFENLTLLPGSTAFFKEAKPSDFYNELKEKLYEGEKGVFIGNGQSVFGK
AGYGSLMAAPMIQNDRLLGFAVLLKQELYAFTFEMYKLFQALIHHATLAVTNSMLRDRLE
HLVKTDQLTELYSRAYLDEKIQYSMKIHQKGVFILVDIDNFKNVNDTYGHQTGDEILIQV
ASVIKSNIRKHDVGARWGGEELAIYLPNVPVAVGKRITERLVYAVRKNTKPEVTISCGIS
CWTTETKKSLKELVHEADEALYSAKRSGKNRLMIHDSIK
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggtagaacaaactaaagatcaattatccgcctttcattatcatatgctcgatttttta
ttaaccaaatctgaaaaagtcacattcaccgactctttcatatggctgacttcggctatt
caaacctatttttcaaccctttgtgtttcgcttacaccgtcaccatcagactttgtgaca
aaactggcagatggtgaagcgcgtttttccgcttcaaaaataaacgcttcatgttatctg
attgaggacggctccggcaggcgtttccatcttgcgtgcaggcaggatgaagagattcct
gaagggcttccggacgtggttgcttcatttttaaaccagtcgatgaaacaggaaagactc
tataacaaaacgatctaccaaaaaaagatatacaaaatgacagagctgttccattcactg
cttgatcagacagatgtgctgaagcagcttttagaaagcttgacaagcacattttctctt
tttgagttttctttatttatatcgcacgatcaagaccaatgtttagggattcctgcaaaa
gagctgtatatggaaggggaaaaatccgattcctttgcgctcaaagtgtatttgtccgga
gacattttgcggaaaaatgaatctgtcgcctatattccgatcaaaggacagcagggcaca
tacggggtgttgaaggctgaaggaacgggtgacagctttcttactgatgcctgccttgat
gaaatgtcgctgttagcaaacgccgcgggaaaagcgtttgaaaatgcccagctctacgaa
caatccaaagcaagcatcgcaaatttggaattgattaatgaaacatcacgacgcctgaat
cagcggctgacattgactgatacaatgaatgatctggctgtgagaatggcagaatcgttt
caggcagaagaagtgggattttttcatatagaccattttgaaaacctaacattgctccca
ggcagcacagcattttttaaagaagcgaagccgtcagatttttataatgagctgaaagaa
aagctgtatgaaggtgaaaaaggggttttcatcgggaatggccagtctgtttttgggaag
gcggggtacggctcgctgatggctgctccgatgattcaaaacgaccggcttttaggcttt
gcggttttattgaaacaggagctgtacgcttttacatttgaaatgtacaagctgtttcag
gcgctgattcatcacgcgacactggctgtaaccaattcaatgcttcgcgaccgccttgag
catctcgtgaaaacagatcagctgactgaactgtattcacgagcgtatttagatgaaaaa
attcaatacagcatgaaaatccatcaaaagggtgtttttattcttgttgatattgataat
tttaaaaatgtaaatgatacgtacggccatcagactggggacgagattttaattcaagtc
gcttcagtgattaaaagcaacatccgaaagcatgatgtcggtgcccgctggggaggagag
gagctggcgatttatttgccaaatgtgccggttgcagtggggaaacggattaccgagcga
ctggtttacgcggtcagaaaaaatacgaaacccgaggtaaccatttcctgcggtatctcc
tgctggacgacagaaacaaaaaagtcgctgaaagagcttgtgcatgaggcagatgaagcg
ctctacagcgcgaaacggagcgggaaaaaccgcttgatgattcatgactcaataaaataa

DBGET integrated database retrieval system