KEGG   Bacillus subtilis subsp. subtilis 168: BSU29650Help
Entry
BSU29650          CDS       T00010                                 

Gene name
dgcP
Definition
(RefSeq) diguanylate cyclase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF GAF_2 GAF_3 GAF
Motif
Other DBs
NCBI-GeneID: 936255
NCBI-ProteinID: NP_390843
Pasteur: BG13918
BSORF: BG13918
UniProt: O34325
Position
complement(3033696..3035435)
Genome map
AA seq 579 aa AA seqDB search
MVEQTKDQLSAFHYHMLDFLLTKSEKVTFTDSFIWLTSAIQTYFSTLCVSLTPSPSDFVT
KLADGEARFSASKINASCYLIEDGSGRRFHLACRQDEEIPEGLPDVVASFLNQSMKQERL
YNKTIYQKKIYKMTELFHSLLDQTDVLKQLLESLTSTFSLFEFSLFISHDQDQCLGIPAK
ELYMEGEKSDSFALKVYLSGDILRKNESVAYIPIKGQQGTYGVLKAEGTGDSFLTDACLD
EMSLLANAAGKAFENAQLYEQSKASIANLELINETSRRLNQRLTLTDTMNDLAVRMAESF
QAEEVGFFHIDHFENLTLLPGSTAFFKEAKPSDFYNELKEKLYEGEKGVFIGNGQSVFGK
AGYGSLMAAPMIQNDRLLGFAVLLKQELYAFTFEMYKLFQALIHHATLAVTNSMLRDRLE
HLVKTDQLTELYSRAYLDEKIQYSMKIHQKGVFILVDIDNFKNVNDTYGHQTGDEILIQV
ASVIKSNIRKHDVGARWGGEELAIYLPNVPVAVGKRITERLVYAVRKNTKPEVTISCGIS
CWTTETKKSLKELVHEADEALYSAKRSGKNRLMIHDSIK
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacaaactaaagatcaattatccgcctttcattatcatatgctcgatttttta
ttaaccaaatctgaaaaagtcacattcaccgactctttcatatggctgacttcggctatt
caaacctatttttcaaccctttgtgtttcgcttacaccgtcaccatcagactttgtgaca
aaactggcagatggtgaagcgcgtttttccgcttcaaaaataaacgcttcatgttatctg
attgaggacggctccggcaggcgtttccatcttgcgtgcaggcaggatgaagagattcct
gaagggcttccggacgtggttgcttcatttttaaaccagtcgatgaaacaggaaagactc
tataacaaaacgatctaccaaaaaaagatatacaaaatgacagagctgttccattcactg
cttgatcagacagatgtgctgaagcagcttttagaaagcttgacaagcacattttctctt
tttgagttttctttatttatatcgcacgatcaagaccaatgtttagggattcctgcaaaa
gagctgtatatggaaggggaaaaatccgattcctttgcgctcaaagtgtatttgtccgga
gacattttgcggaaaaatgaatctgtcgcctatattccgatcaaaggacagcagggcaca
tacggggtgttgaaggctgaaggaacgggtgacagctttcttactgatgcctgccttgat
gaaatgtcgctgttagcaaacgccgcgggaaaagcgtttgaaaatgcccagctctacgaa
caatccaaagcaagcatcgcaaatttggaattgattaatgaaacatcacgacgcctgaat
cagcggctgacattgactgatacaatgaatgatctggctgtgagaatggcagaatcgttt
caggcagaagaagtgggattttttcatatagaccattttgaaaacctaacattgctccca
ggcagcacagcattttttaaagaagcgaagccgtcagatttttataatgagctgaaagaa
aagctgtatgaaggtgaaaaaggggttttcatcgggaatggccagtctgtttttgggaag
gcggggtacggctcgctgatggctgctccgatgattcaaaacgaccggcttttaggcttt
gcggttttattgaaacaggagctgtacgcttttacatttgaaatgtacaagctgtttcag
gcgctgattcatcacgcgacactggctgtaaccaattcaatgcttcgcgaccgccttgag
catctcgtgaaaacagatcagctgactgaactgtattcacgagcgtatttagatgaaaaa
attcaatacagcatgaaaatccatcaaaagggtgtttttattcttgttgatattgataat
tttaaaaatgtaaatgatacgtacggccatcagactggggacgagattttaattcaagtc
gcttcagtgattaaaagcaacatccgaaagcatgatgtcggtgcccgctggggaggagag
gagctggcgatttatttgccaaatgtgccggttgcagtggggaaacggattaccgagcga
ctggtttacgcggtcagaaaaaatacgaaacccgaggtaaccatttcctgcggtatctcc
tgctggacgacagaaacaaaaaagtcgctgaaagagcttgtgcatgaggcagatgaagcg
ctctacagcgcgaaacggagcgggaaaaaccgcttgatgattcatgactcaataaaataa

DBGET integrated database retrieval system