KEGG   Bacillus subtilis subsp. subtilis 168: BSU29679Help
Entry
BSU29679          CDS       T00010                                 

Gene name
ytzK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303078
NCBI-ProteinID: YP_003097773
Position
complement(3038060..3038203)
Genome map
AA seq 47 aa AA seqDB search
MTQDFIYVKNDIASYEKVKIETSRISLRSRELMAGENQHRRIYRIHS
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
ttgacacaggattttatttatgttaaaaatgatatagcttcatatgaaaaggtaaagatt
gagacaagtagaatatccttacgttccagagagctgatggccggtgaaaatcagcacaga
cggatatatcgaatacactcatga

DBGET integrated database retrieval system