KEGG   Bacillus subtilis subsp. subtilis 168: BSU29680
Entry
BSU29680          CDS       T00010                                 

Symbol
acsA
Name
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00620  Pyruvate metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00640  Propanoate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU29680 (acsA)
   00620 Pyruvate metabolism
    BSU29680 (acsA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSU29680 (acsA)
   00640 Propanoate metabolism
    BSU29680 (acsA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU29680 (acsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU29680 (acsA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSU29680 (acsA)
Lipid biosynthesis proteins [BR:bsu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSU29680 (acsA)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 937324
NCBI-ProteinID: NP_390846
Pasteur: BG10370
BSORF: BG10370
UniProt: P39062 A0A6M4JL50
Position
complement(3038213..3039931)
AA seq 572 aa
MNLKALPAIEGDHNLKNYEETYRHFDWAEAEKHFSWHETGKLNAAYEAIDRHAESFRKNK
VALYYKDAKRDEKYTFKEMKEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLENSEAKVVVTTPELLERIPVDKLPHLQHVFVVGGEAES
GTNIINYDEAAKQESTRLDIEWMDKKDGFLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEEDIYWCTADPGWVTGTVYGIFAPWLNGATNVIVGGRFSPESWYGTIEQLGVNVW
YSAPTAFRMLMGAGDEMAAKYDLTSLRHVLSVGEPLNPEVIRWGHKVFNKRIHDTWWMTE
TGSQLICNYPCMDIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMHTIW
NNPEKYESYFMPGGWYVSGDSAYMDEEGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGFEPSDKLKEEIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgaacttgaaagcgttaccagcaatagagggggatcataacttaaaaaactatgaagaa
acgtaccggcattttgattgggccgaggcagagaaacatttctcttggcatgagacaggg
aaactgaatgcggcgtatgaagcgattgaccgccatgccgaatcgtttcgaaaaaacaaa
gtagcgctttattataaagacgcaaaaagggatgaaaaatacacatttaaagaaatgaag
gaagaatcaaacagagccgggaatgtgctgagacggtatggaaatgtggaaaaaggggac
cgcgtttttatttttatgccgagatcacccgagctttattttattatgcttggcgcaatc
aaaattggcgccatcgccgggccgctgttcgaagcatttatggagggagcggtgaaagac
cggcttgaaaacagtgaggcaaaggttgttgtcacaacgcctgagctgctggagagaata
ccggtagacaaactgcctcacttgcagcatgtcttcgtagtcgggggagaggctgagagc
ggcacgaatatcatcaattatgatgaagcagcgaaacaggaaagcacaagattggatatc
gaatggatggataaaaaagacggctttctgcttcactatacatcaggttccactggtacg
ccaaagggcgtgttgcatgtccatgaagcgatgattcagcaatatcaaacaggaaagtgg
gtccttgatttaaaggaagaagacatttattggtgcacggctgatccaggctgggtgaca
ggtacggtatacggcatttttgcaccgtggctgaacggagcgacaaatgtcatcgtcggc
ggacgtttcagcccggaaagctggtatggaacgattgaacagcttggcgtcaatgtctgg
tacagcgcgccgacagcttttcggatgctgatgggagcgggagatgaaatggctgcgaaa
tatgatctaacttcactccggcatgtgctcagtgtcggtgagccgctaaatccggaagtc
atcagatggggacataaagtttttaacaaacgaatccatgatacctggtggatgaccgaa
acgggcagtcagctcatctgcaactatccttgcatggatattaaaccgggttcaatgggt
aagccgattccaggagtggaggcagcgatcgttgacaatcaaggcaacgagctaccgccg
taccgaatgggcaatctcgccatcaaaaagggctggccttccatgatgcataccatttgg
aataaccctgaaaagtatgaatcgtatttcatgccgggcggctggtatgtgtctggggat
tctgcttacatggatgaagagggatacttttggttccaaggcagagttgatgacgtcatc
atgacctccggtgagcgcgtcggcccatttgaagtggaaagcaagcttgtcgaacatccg
gctattgcagaagcaggcgttatcggaaagcctgacccggtgcgtggagaaatcattaaa
gcctttattgcactcagggaaggatttgagccgtctgataaactgaaagaagagatccgc
ctatttgtaaagcagggtcttgcagcccatgcggctccgcgtgagatcgaatttaaagat
aagcttccgaaaaccagaagcggaaagatcatgaggcgcgtgctgaaggcatgggagctt
aatctgccggctggagatctgtcaacaatggaggattaa

DBGET integrated database retrieval system