KEGG   Bacillus subtilis subsp. subtilis 168: BSU29690Help
Entry
BSU29690          CDS       T00010                                 

Gene name
acuA
Definition
(RefSeq) acetoin utilization protein AcuA
  KO
K04766  acetoin utilization protein AcuA [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU29690 (acuA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU29690 (acuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 937633
NCBI-ProteinID: NP_390847
Pasteur: BG10369
BSORF: BG10369
UniProt: P39065
Position
3040092..3040724
Genome map
AA seq 210 aa AA seqDB search
MEHHKTYHSANIKTATGSLLIEGPVSPEDLAGYEFHKDLTAFRPPREQHEALVDIAGLPE
GRIIIARDGRTIVGYVTYLYPDPLERWSEGNMEDLIELGAIEVAPDYRGCAVGKTLLTVS
MMDEQMENYIVMTTEYYWHWDLKGMKKDVWEYRKIMEKMMNAGGLVWFATDEPEISSHPA
NCLMARIGKNVSQESIEQFDRLRFYHRYMY
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggaacatcataaaacataccattcagcaaacatcaaaacagcaaccggctctttactg
atagaagggcctgtctctccagaggatttggcaggttatgagtttcataaagatttaacc
gcatttcgcccgcctcgcgagcagcatgaagcgctagtcgacattgcaggccttcccgaa
gggcgcattattattgccagagacggccgaaccattgtcggctatgtcacgtatttatat
cctgacccgctcgaaagatggtctgaaggaaatatggaggatttgattgagctcggagcc
atcgaagtagcgccggactatcggggatgcgctgtcggaaagacgctcctgaccgtcagc
atgatggatgaacaaatggaaaactacattgtgatgacgacagaatattactggcattgg
gatttaaaagggatgaaaaaagatgtgtgggaatacagaaagatcatggaaaagatgatg
aatgcaggcggattggtctggtttgcaacggatgagccggagatcagctcccaccctgca
aactgtctgatggcccgcattggaaaaaacgtcagccaagaatcaattgagcaatttgac
aggctccgtttttatcatcgttatatgtattaa

DBGET integrated database retrieval system