KEGG   Bacillus subtilis subsp. subtilis 168: BSU29700Help
Entry
BSU29700          CDS       T00010                                 

Gene name
acuB
Definition
(RefSeq) acetoin utilization protein AcuB
  KO
K04767  acetoin utilization protein AcuB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU29700 (acuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBS ACT RNase_P_pop3
Motif
Other DBs
NCBI-GeneID: 937318
NCBI-ProteinID: NP_390848
Pasteur: BG10368
BSORF: BG10368
UniProt: P39066
Position
3040751..3041395
Genome map
AA seq 214 aa AA seqDB search
MIVEQIMKRDVITLTKTDTLETAICKLKEFHIRHLPVVDEERHVIGMITDRDMKQASPSI
FEENKRSLFLTRSVDSIMKKDVVCAHPLDFVEEISAVFYEHGIGCLPVVHHQKLIGILTK
TDLLRTFVKLTGADQPGSQIEIKVNDITKSLAEISSLCQDLQVKILSVLVYPHDDPGVKV
LVFRVKTMNPLPFLQALQRNGHHVVWPSEQRDLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgattgttgagcaaatcatgaaaagagatgtcattacattaacgaagacggatacgctt
gaaacagcaatatgcaaactgaaggaattccatatcaggcatctgcctgttgtagatgaa
gaacgacacgtgatcggcatgattacagacagggacatgaaacaggccagcccgagtatt
tttgaagaaaacaaacgaagcctatttctcacacgaagcgtagattcaattatgaaaaag
gatgttgtctgcgcccacccgttagattttgtcgaagaaatatcagccgtgttctacgag
catggcatcggctgcctaccagtggtacaccatcaaaaattaataggcattttaacaaaa
accgatttgctgcggacgtttgtcaaattgacaggcgctgaccagccgggctcgcaaatt
gagataaaagtaaacgacatcaccaaaagcctcgctgagatcagcagtctttgccaagac
cttcaagtgaaaatattaagcgtgcttgtttatccgcatgacgatcccggtgtaaaagtg
cttgtcttccgtgtaaaaacgatgaatccgctgccgtttttgcaggcattacaaagaaat
ggacaccacgtcgtatggccgtcagagcaaagggatctgctatga

DBGET integrated database retrieval system