KEGG   Bacillus subtilis subsp. subtilis 168: BSU29710
Entry
BSU29710          CDS       T00010                                 

Symbol
acuC
Name
(RefSeq) acetoin utilization protein AcuC
  KO
K04768  acetoin utilization protein AcuC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU29710 (acuC)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 936834
NCBI-ProteinID: NP_390849
Pasteur: BG10367
BSORF: BG10367
UniProt: P39067 A0A6M3ZIG1
Position
3041392..3042555
AA seq 387 aa
MRDSVFIYSPSYQTYMFHQEHPFNQQRVLLTYDLLKTINAFDDGDIVTPRLASEEELSLV
HTDDYIQAVKLAGAGKLPAEEGESYGLGTEDTPVFAGMHEAASLLVGGTLTAADWVMSGQ
ALHAANLGGGLHHGFRGRASGFCIYNDSAVAIQYIQKKYSARVLYIDTDAHHGDGVQFTF
YDNPDVCTLSIHETGRYLFPGTGQIQEKGSGKGYGYSFNIPLDAFTEDDSFLEAYRTAAS
EVAAYFEPDVIISQNGADAHYYDPLTHLSATINIYEEIPRLAHTLAHQYCGGKWIAVGGG
GYDIWRVVPRAWARIWLEMKGIDPGHEIPPEWIVKWQKQCPVALPSSWSDPADLYPPIPR
KPEITEKNAQTVSKALYAIRSEQQRTK
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgagagacagtgtatttatctattctccatcctaccaaacctatatgtttcatcaggag
catccctttaatcagcagcgggttctgttaacatatgatttgcttaagacgatcaatgcc
tttgatgatggagacattgtcacccccagactcgcttcagaagaggagctttcccttgtc
cacacggacgattacattcaggccgtaaagcttgcgggcgccggaaagctccccgctgaa
gaaggagaaagctacgggctcggcactgaagacacacccgtctttgccggcatgcacgaa
gcggcatcactcttggtcggcggcactttaacggccgcagactgggtcatgtcaggacaa
gccctgcatgcggcaaaccttggcggagggcttcatcacggctttcgcgggagagcatca
ggattctgcatatacaacgacagcgctgtggctattcaatatatccagaaaaaatatagc
gccagagtgctttatattgatacggacgcccaccacggggacggtgtgcaatttacattt
tacgataatcctgacgtatgcacgctgtccattcatgaaacaggaaggtatttattccct
ggaaccggtcagatccaagaaaaaggaagcggaaaaggatatggctattcctttaatatt
ccgcttgacgcttttacagaggatgattcttttcttgaggcttaccggacagcagcttca
gaagtcgccgcgtatttcgagcccgatgtcattatcagccaaaacggcgccgatgcccat
tactacgacccgctgacgcatttatcagcaacaatcaatatatacgaagaaatcccccgt
cttgcacacactttggctcatcaatattgcggagggaaatggattgcagtcggaggcggc
ggatatgatatttggcgtgtcgtgccccgcgcctgggccagaatatggcttgaaatgaag
ggaattgacccgggtcacgagatcccgccggaatggattgttaaatggcaaaaacaatgc
cccgtggcccttccgtcgagctggagcgatccggctgatttatatcctccgattccccgc
aagcctgaaattacagaaaaaaatgcccaaactgtcagcaaagcattatatgcgatacgt
tctgaacagcaaagaacaaagtaa

DBGET integrated database retrieval system