KEGG   Bacillus subtilis subsp. subtilis 168: BSU29720
Entry
BSU29720          CDS       T00010                                 

Symbol
ytxE
Name
(RefSeq) hypothetical protein
  KO
K02557  chemotaxis protein MotB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU29720 (ytxE)
   02040 Flagellar assembly
    BSU29720 (ytxE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU29720 (ytxE)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU29720 (ytxE)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU29720 (ytxE)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Stator
    BSU29720 (ytxE)
SSDB
Motif
Pfam: OmpA MotB_plug
Other DBs
NCBI-GeneID: 937315
NCBI-ProteinID: NP_390850
Pasteur: BG10366
BSORF: BG10366
UniProt: P39064 A0A6M4JM04
Position
complement(3042566..3043294)
AA seq 242 aa
MKLRRERFERRNGSGKNSQSSSSWMVTFTDLITLILVFFILLFSMSQIDLQKFKAAVDSI
QKEGNGLQPDQTSIEKKNTSPSDTKKQEDQQDQLLKKVNTYIKDNHLKAQMTAKRDERGV
VLVLQEAVLFDTGEAKVLKNAETLLHQIAVLLQTIPNDIQVEGHTDSRNISTYRYPSNWE
LSAARASGVIQYFTSKEKLPSKRFIAVGYADTKPVKDNKTNEHMKENRRVEIVIKKSKTT
SS
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaagcttagaagagaacgttttgaaagaaggaatggaagcggaaaaaacagtcaatct
tcatccagctggatggtaacctttacagatctgatcaccttgatccttgtgttctttatt
ttactcttttcgatgtcccaaatcgatctgcaaaaattcaaagcggcagtggactcgatc
cagaaggaaggcaacgggcttcagccggaccaaacatccatagaaaaaaagaatacatcc
ccatctgatacgaagaagcaagaggatcagcaggatcagcttctcaagaaagtaaataca
tatataaaagacaatcatttgaaggcccaaatgacagccaaacgggatgaacgcggtgtc
gtgctcgttcttcaggaggctgtgctgtttgatacaggtgaggcaaaggtgctgaaaaat
gccgaaacacttcttcaccaaattgccgttcttcttcaaacaattccaaatgacattcag
gttgagggacatacagacagccgaaacatttcgacataccgatacccgtcgaactgggag
ctatcagcagcacgggcaagtggagtgattcaatacttcacgtctaaagagaagcttccc
tccaagcgctttattgctgtcggttatgcggatacaaagccagtaaaggataacaagaca
aatgaacacatgaaggaaaatcggcgtgtggaaatagtgattaaaaaatcaaaaacgacc
tcttcgtaa

DBGET integrated database retrieval system