KEGG   Bacillus subtilis subsp. subtilis 168: BSU29730
Entry
BSU29730          CDS       T00010                                 

Symbol
ytxD
Name
(RefSeq) hypothetical protein
  KO
K02556  chemotaxis protein MotA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU29730 (ytxD)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU29730 (ytxD)
   02040 Flagellar assembly
    BSU29730 (ytxD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU29730 (ytxD)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU29730 (ytxD)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU29730 (ytxD)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Stator
    BSU29730 (ytxD)
SSDB
Motif
Pfam: MotA_ExbB
Other DBs
NCBI-GeneID: 937317
NCBI-ProteinID: NP_390851
Pasteur: BG10365
BSORF: BG10365
UniProt: P39063 A0A6M3ZM97
Position
complement(3043284..3044102)
AA seq 272 aa
MKRFDYLTPVGFVLGTIIIVIGIISGSGVSGFRSFLDLTSFFIVTGGLCAAVFISFPPSE
LKKAPSVLKQAFIRQEDNVKDLVKTFVSLSDHARKHGLLSLDDQAREIKDPFLKKGLLLA
IDGWDEETIRLVMDSEIAAMEERHRKGRRVFEKAGEFAPAWGMIGTLVGLVLMLKNLNDP
HMLGPNMAIALLTTLYGSLLANMVFNPIAAKLEEKTESEIFIKQVMVEGIIGVQSGKNPR
NLESQLVVFSSREEWQKQPKQVKTKKGSVHEA
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaaacgttttgattatcttacacctgttggatttgtgttaggaacgattattattgtt
atcgggattatttcaggatcgggagtaagcggtttccgctcttttcttgatctgacctct
ttcttcatcgtaacagggggactttgcgccgctgtttttatcagttttccgccaagtgag
ctgaaaaaagcgccctctgtgttaaagcaggcattcatccgccaggaagacaatgtgaaa
gatcttgtgaaaacctttgtttccctttccgatcacgcgcgaaaacacgggcttttatca
ttggatgatcaggctcgggaaatcaaagatccattcttgaaaaaagggctgcttttagcg
attgacggctgggatgaagaaacgattcggctcgtcatggattcagaaatcgcagcaatg
gaggaacggcaccgaaaagggcggcgagtttttgaaaaagcgggagaattcgctccggca
tggggaatgatcggaacactcgtcgggcttgtgctgatgctcaaaaacttaaacgacccg
catatgctcggaccaaacatggccattgcgcttctgacgactttatatggttcattactg
gcaaatatggtcttcaacccgatcgcggctaagcttgaagagaaaacagaaagtgaaatt
ttcatcaagcaggtaatggtggaagggattatcggtgttcaatccggaaaaaacccgcgc
aaccttgaaagccagctggtcgttttcagctcacgggaagaatggcagaagcagccaaaa
caagtaaaaacaaaaaagggatctgtacatgaagcttag

DBGET integrated database retrieval system