KEGG   Bacillus subtilis subsp. subtilis 168: BSU29750
Entry
BSU29750          CDS       T00010                                 

Symbol
aroA
Name
(RefSeq) 5-enolpyruvylshikimate-3-phosphate synthetase AroA
  KO
K13853  3-deoxy-7-phosphoheptulonate synthase / chorismate mutase [EC:2.5.1.54 5.4.99.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU29750 (aroA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BSU29750 (aroA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     BSU29750 (aroA)
SSDB
Motif
Pfam: DAHP_synth_1 CM_2 NeuB HOOK GFO_IDH_MocA
Other DBs
NCBI-GeneID: 937853
NCBI-ProteinID: NP_390853
Pasteur: BG10375
BSORF: BG10375
UniProt: P39912 A0A6M4JNY1
Structure
PDB: 
5GMU 5GO2

Position
complement(3045445..3046521)
AA seq 358 aa
MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIE
NNDGPFENSTIQHIFKEIFKAGLELQEEDHSKALLVSRKKKPEDTIVDIKGEKIGDGQQR
FIVGPCAVESYEQVAEVAAAAKKQGIKILRGGAFKPRTSPYDFQGLGVEGLQILKRVADE
FDLAVISEIVTPAHIEEALDYIDVIQIGARNMQNFELLKAAGAVKKPVLLKRGLAATISE
FINAAEYIMSQGNDQIILCERGIRTYETATRNTLDISAVPILKQETHLPVFVDVTHSTGR
RDLLLPTAKAALAIGADGVMAEVHPDPSVALSDSAQQMAIPEFEKWLNELKPMVKVNA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgagcaacacagagttagagcttttaaggcagaaagcagacgaattaaacctacaaatt
ttaaaattaatcaacgaacgcggcaatgttgtaaaagagatcggtaaagcgaaggaagca
cagggtgtcaaccgatttgaccctgtcagagaacgcacaatgttaaacaatatcattgaa
aacaatgacgggccgttcgaaaattcaaccatccagcacatttttaaagagatattcaaa
gccggtttagagcttcaggaagaagatcacagcaaagcgctgcttgtctcccgcaagaaa
aaacctgaagatacaattgttgatatcaaaggcgaaaaaatcggagacggccagcaaaga
ttcattgtcggcccatgtgcggtagagagctatgagcaggtagctgaagtcgctgcagct
gcgaaaaaacaagggattaaaattttgcgcggtggagcctttaagcctcgtacgagccca
tacgatttccaagggcttggtgttgaaggccttcaaattttaaaacgtgtagcggatgaa
tttgatctggcggttatcagtgaaatcgtaactccggctcatatcgaagaagcgctggac
tacattgatgtcattcaaatcggagcgcgcaacatgcaaaacttcgaattgctgaaagcg
gccggcgccgtgaaaaagccagtgcttctgaagcgcggtcttgctgcaacgatctctgaa
ttcatcaatgctgctgaatacatcatgtcacaaggaaatgaccaaattatcctttgtgag
cgcggaatcagaacatatgaaacagcaacgagaaacacgctggatatttcagctgtgccg
attttgaaacaagaaacgcatttgccagtctttgttgatgttacgcattcaacaggccgc
cgtgacctcttgcttccgacagctaaagccgctttagcgatcggtgctgatggcgtaatg
gctgaggttcaccctgatccgtcagtcgcactttctgactctgctcagcaaatggcgatt
cctgaattcgaaaaatggctgaatgaactgaagccaatggtgaaagtcaacgcttaa

DBGET integrated database retrieval system