KEGG   Bacillus subtilis subsp. subtilis 168: BSU29760
Entry
BSU29760          CDS       T00010                                 

Gene name
ytxJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: DUF2847
Other DBs
NCBI-GeneID: 937308
NCBI-ProteinID: NP_390854
Pasteur: BG10373
BSORF: BG10373
UniProt: P39914 A0A6M4JNQ9
Position
complement(3046757..3047083)
AA seq 108 aa
MAKQLIQSEEEFKRIAEQEGVFVFLKHSTTCPISQAAFHEFDAFANQHEDVPAYYLQVQE
ARPLSNFIAETYGVKHESPQIFIIQNGEVKWHTSHSQITEAAIEQHLS
NT seq 327 nt   +upstreamnt  +downstreamnt
atggctaaacagcttattcaatctgaggaagaatttaaacggattgcagaacaggaaggc
gttttcgtcttcttgaaacacagcaccacatgcccgatcagccaggcagcatttcatgag
tttgatgcctttgcaaatcagcatgaggatgtgccggcttactatcttcaagtacaagaa
gcccggccgctgtccaatttcattgcagaaacatatggggtcaagcatgaaagccctcag
atattcatcatccagaacggtgaagtgaaatggcatacctcacattcacaaattacagaa
gccgctattgagcagcatttgtcatag

DBGET integrated database retrieval system