KEGG   Bacillus subtilis subsp. subtilis 168: BSU29770
Entry
BSU29770          CDS       T00010                                 

Symbol
ytxH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YtxH Tis11B_N ISG65-75
Other DBs
NCBI-GeneID: 937312
NCBI-ProteinID: NP_390855
Pasteur: BG10975
BSORF: BG10975
UniProt: P40780 A0A6M4JKH6
Position
complement(3047107..3047562)
AA seq 151 aa
MSKDGINSKDFLIGTLIGGIIGATTALFLAPKSGKELRDDLGSQAVALRDKTDKMTADAK
EKGTQYVSIAKDKTSNITQLVADQSGQIMNKVKDLRDRSKSDKTDSSTAMQDMREEAMQA
ADETKDQVLQTKEDVKDELKDAQKQAEQLNR
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagcaaagatggaattaatagtaaagattttttaatcggaactttaatcgggggaatc
atcggtgccactacagctctttttctagcgcctaaatcaggcaaagaacttcgcgacgat
ctcggcagccaggctgttgccttacgggacaaaactgataaaatgacggcagatgcgaag
gaaaaaggcacgcaatatgtcagcatcgcaaaagacaaaacttccaacatcacacagctt
gtagcggatcagtctggacagatcatgaacaaggtaaaggatttgagagaccgttccaaa
tctgacaaaacggattcatcgactgcaatgcaagatatgagggaagaagcgatgcaggca
gctgatgaaacaaaagatcaagtcctccagacgaaagaagatgtaaaagacgaactgaaa
gatgcacaaaaacaggctgagcagttgaatcgctga

DBGET integrated database retrieval system