KEGG   Bacillus subtilis subsp. subtilis 168: BSU29790Help
Entry
BSU29790          CDS       T00010                                 

Gene name
murC
Definition
(RefSeq) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00471  D-Glutamine and D-glutamate metabolism
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU29790 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU29790 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU29790 (murC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BSU29790 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Amino acid ligase
   BSU29790 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 937311
NCBI-ProteinID: NP_390857
Pasteur: BG10973
BSORF: BG10973
UniProt: P40778
Position
complement(3048177..3049475)
Genome map
AA seq 432 aa AA seqDB search
MTVYHFVGIKGTGMSPLAQILHDNGYTVQGSDIEKFIFTQTALEKRNITILPFSAENIKP
GMTVIAGNAFPDTHPEIEKAMSEGIPVIRYHKFLGDYMKKFTSVAVTGAHGKTSTTGLLA
HVIQNAKPTSFLIGDGTGQGNENSEYFVFEACEYRRHFLSYQPDYAIMTNIDFDHPDYFS
SIDDVFDAFQEMALQVNKGIIACGDDEHLPKIHANVPVVYYGTGEENDFQARNIVKSTEG
TTFDVFVRNTFYDTFYIPAYGHHNVLNSLAVIALCHYEEIDSSIIKHALKSFGGVKRRFN
EKQLGDQVLIDDYAHHPTEIKVTIEAARQKYPDREIVAVFQPHTFTRTQQFLDEFAESLS
GADCVYLCDIFGSARENAGKLTIGDLQGKIHNAKLIEEDDTSVLKAHDKAVLIFMGAGDI
QKYMRAYENVMA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttatcattttgttggaataaaagggaccggtatgagtccgcttgcccaaata
cttcatgataatggatatactgtccaaggatcggatatcgaaaaatttatttttacgcaa
acagcgcttgaaaaaagaaatattacgattcttccttttagcgcggaaaatattaaaccc
ggcatgacagtcatcgccggaaacgcattcccagacacgcatcctgaaatagaaaaagcg
atgtctgagggaattccggtgatacgttatcataagtttttaggcgactacatgaaaaaa
ttcacgagtgttgccgttacgggcgcacacggcaaaacgtcgactacgggtctgctggct
cacgtgatccaaaacgcaaaaccgacgtctttcttaatcggagacggaacaggccaggga
aatgaaaacagcgaatactttgtgtttgaagcgtgcgaataccgccgccatttcttaagc
tatcagccagattatgcgattatgacgaatattgattttgatcaccctgattacttctca
agcattgacgatgtatttgacgctttccaagagatggctcttcaagtcaacaaaggcatt
attgcctgcggagacgatgagcatctgccgaaaatccatgcgaacgtcccggttgtgtat
tatggcacgggggaagaaaatgattttcaagccagaaacatcgtaaaaagcacggaaggg
acaacttttgatgtctttgtccgcaatacgttctatgatacgttttatattcctgcgtac
ggccaccacaatgtattaaactcattggcggtcattgcgttatgccattatgaagaaatt
gattccagcatcattaagcatgctctcaaatcctttgggggcgtcaaacgcagattcaat
gagaagcagcttggggatcaagtgctgattgatgactatgcccatcatccgacagaaata
aaagtgacaatcgaggcggcaagacagaagtatcctgatcgggaaattgtcgcggtattc
cagcctcatacatttacccggacgcagcagttccttgacgaatttgcagaaagcctgagc
ggcgccgactgtgtgtatttatgcgatattttcggctcagcccgtgagaatgccggaaag
ctgacgatcggtgatctccagggaaaaattcataatgccaagctgattgaagaagatgac
acatctgttttaaaagctcatgataaagccgttctcatcttcatgggagcaggagatatc
caaaaatatatgagagcctacgaaaacgtcatggcataa

DBGET integrated database retrieval system