KEGG   Bacillus subtilis subsp. subtilis 168: BSU29820
Entry
BSU29820          CDS       T00010                                 

Symbol
ytpR
Name
(RefSeq) tRNA-binding protein YtpR
  KO
K06878  tRNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU29820 (ytpR)
SSDB
Motif
Pfam: tRNA_bind DUF4479 PAC2
Other DBs
NCBI-GeneID: 937964
NCBI-ProteinID: NP_390860
Pasteur: BG13905
BSORF: BG13905
UniProt: O34943 A0A6M4JMI2
Position
complement(3052743..3053348)
AA seq 201 aa
MNAFYNKEGVGDTLLISLQDVTREQLGYEKHGDVVKIFNNETKETTGFNIFNASSYLTID
ENGPVALSETFVQDVNEILNRNGVEETLVVDLSPKFVVGYVESKEKHPNADKLSVCKVNV
GEETLQIVCGAPNVDQGQKVVVAKVGAVMPSGLVIKDAELRGVPSSGMICSAKELDLPDA
PAEKGILVLEGDYEAGDAFQF
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaacgctttttataataaagaaggtgtgggagacacgctcctgatctctcttcaagat
gtgacacgcgaacaattaggctatgaaaaacacggcgacgtcgtcaaaattttcaataac
gaaacaaaagaaacaacgggcttcaacattttcaatgcgtcttcttacttgaccattgat
gaaaacggccctgttgcgctctcagaaacattcgtgcaagatgtgaatgagattttaaac
agaaacggcgttgaagaaacattagtcgttgatttatctccgaagtttgttgtgggttat
gtagaatcaaaagaaaaacatccgaatgcggataaattaagcgtatgtaaagtcaacgta
ggagaagaaacgcttcagatcgtctgcggcgcgcctaacgttgaccaaggccaaaaagtt
gtcgttgccaaagtcggtgctgtgatgcctagcggacttgtcattaaggatgcagagctt
cgtggcgttccgtcaagcgggatgatctgctcagcgaaagagcttgatttgccggatgcc
cctgctgaaaaaggaatccttgtgttagaaggagactatgaggcgggagacgcatttcag
ttttag

DBGET integrated database retrieval system