KEGG   Bacillus subtilis subsp. subtilis 168: BSU29830
Entry
BSU29830          CDS       T00010                                 

Symbol
ytpQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1444
Other DBs
NCBI-GeneID: 937506
NCBI-ProteinID: NP_390861
Pasteur: BG13904
BSORF: BG13904
UniProt: O34496 A0A6M3ZFA7
Position
complement(3053364..3054173)
AA seq 269 aa
MKMTSRKLSDILKQRLQHENRSFLFDREKDTLRVEDQTTKKGITLDLPPIIAKWELKKDE
AIDEIVYYVSEAMTAMEGKAQEMTGKETRIYPVIRSTSFPDKSSEDIPLIYDDHTAETRI
YYALDLGKTYRLIDQRMLEKENWTKERIRETAAFNLRSLPTVVKEDTVAGNYFYFFRAND
GYDASRILNEAILNEYKQHAEGELAISVPHQDVLILADIRNESGYDILGQMSMSFFAGGT
VPITALSFLYNEGKLEPVFILAKSRPKKD
NT seq 810 nt   +upstreamnt  +downstreamnt
ttgaaaatgacctcaaggaagctgtcagatatactgaagcagcgccttcagcacgagaat
cgctcctttctgtttgacagagaaaaagacaccctccgtgttgaggatcaaacgactaaa
aaagggattacactcgatttgccgccgattattgcaaaatgggaactgaaaaaagacgaa
gccattgatgagatcgtgtactatgtctccgaagcgatgacggcaatggaagggaaggct
caggaaatgaccgggaaagaaactcgcatttatccggtcatccgctcgacttccttcccg
gacaagtccagcgaagatatcccgctcatttatgacgatcataccgcagagacaagaatt
tattacgcgctagatctcgggaaaacctaccgtttaattgaccagcgcatgcttgagaaa
gaaaactggacaaaagagcggatcagagagacggccgcatttaatctccgttccctgccg
acggttgtcaaagaggatacggttgccggcaattacttttatttcttcagggcaaacgac
ggatacgacgcaagccggattttgaacgaagcgatcttaaatgagtataagcagcatgca
gaaggtgagctggcgatctctgttcctcatcaggacgttttgattcttgctgacatccgg
aatgaatcggggtatgatattctaggacaaatgtcgatgagcttctttgcaggcggcacc
gtcccgattaccgccctatcatttttgtacaatgaaggaaagctggaaccggtgtttatc
ctggcgaaaagccgtccgaaaaaggattag

DBGET integrated database retrieval system