KEGG   Bacillus subtilis subsp. subtilis 168: BSU29860
Entry
BSU29860          CDS       T00010                                 

Symbol
ytoP
Name
(RefSeq) aminopeptidase YtoP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28
Other DBs
NCBI-GeneID: 937301
NCBI-ProteinID: NP_390864
Pasteur: BG13898
BSORF: BG13898
UniProt: O34924 A0A6M4JNR1
Position
complement(3055247..3056320)
AA seq 357 aa
MNQETKALFQTLTQLPGAPGNEHQVRAFMKQELAKYADDIVQDRLGSVFGVRRGAEDAPR
IMVAGHMDEVGFMVTSITDNGLLRFQTLGGWWSQVLLAQRVEIQTDNGPVPGVISSIPPH
LLTDAQRNRPMDIKNMMIDIGADDKEDAIKIGIRPGQQIVPVCPFTTMANEKKILSKAWD
NRYGCGLSIELLKELHGKELPNTLYAGATVQEEVGLRGAQTASHMIKPDLFFALDASPAN
DMSGDKNEFGQLGKGFLLRILDRTTVMHRGMREFVLDMAETHDIPYQYFVSGGGTDAGKV
HISNSGVPSAVIGICSRYIHTNATIIHIDDYAAAKEMLIKLVTACDKQTVDAIKENM
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaatcaagaaacgaaagcgcttttccaaacactgacgcagcttcccggcgcgccgggc
aatgagcatcaggttcgtgcttttatgaagcaggagctagccaaatatgcagatgacatc
gttcaggacagactgggaagtgttttcggagtcagacgaggcgcagaggacgcaccgaga
attatggtagccgggcacatggacgaagtcggcttcatggtgacatccattacagacaac
gggctgctcagattccagacgctcggaggctggtggagccaagttttgcttgcgcagcgg
gttgaaattcaaacagataacgggccggttccgggtgtgatttcaagcataccgccgcat
ttattgacagatgcgcagcgaaaccgaccgatggatatcaaaaacatgatgatcgacatt
ggagcggatgataaggaagacgccatcaaaatcggcattagaccgggacagcagatcgtg
cctgtttgtccgtttacgacgatggcgaatgaaaagaaaattttatcaaaagcatgggat
aacagatatggatgcggcttaagcattgaacttctgaaggaattacacggtaaagagctt
ccgaatacactctatgcgggtgcaacggttcaggaagaagtagggctaaggggcgcgcag
acggcttctcatatgattaaaccggacttgtttttcgcccttgacgccagcccggcaaac
gatatgagcggagacaaaaatgaattcggccagcttggaaaaggctttttgctgcgcatt
cttgacagaacgacagtcatgcatcgcggaatgagggaattcgttcttgatatggctgaa
acgcatgatattccatatcaatattttgtatccggcgggggaacagacgcaggcaaggtt
catatttcgaacagcggtgtgccgtcagcggttatcggaatatgttcccgctatattcat
acaaacgctactatcattcatattgatgattatgctgctgctaaagaaatgctcatcaaa
cttgtaacagcctgcgataagcagacagtggatgcgattaaagaaaatatgtag

DBGET integrated database retrieval system