KEGG   Bacillus subtilis subsp. subtilis 168: BSU29870
Entry
BSU29870          CDS       T00010                                 

Gene name
ytzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: PepSY
Other DBs
NCBI-GeneID: 937300
NCBI-ProteinID: NP_390865
Pasteur: BG13936
BSORF: BG13936
UniProt: O32065 A0A6M4JKI3
Position
3056479..3056796
AA seq 105 aa
MKLRHLLLGAGLGICTAVVVRQYVMKPYISSEKALRIVKSAFKQRGPIDGSWIYTQPEPY
NINGETVQVYKTGITRSAFGELEQYEVMVDAKTGEIVDVIDTIAS
NT seq 318 nt   +upstreamnt  +downstreamnt
ttgaaattgcgtcatcttcttttaggagcaggacttggaatttgtacggctgtcgttgtg
agacaatatgtgatgaagccttatatttcttcagaaaaagcgcttcgaattgtaaaatct
gcttttaagcagcggggcccgattgacggatcatggatttacacccagccggagccctac
aatattaacggagaaacggtacaggtatacaaaaccggcattacacgatcagctttcgga
gaattagaacagtatgaagtcatggtggatgcgaaaacgggagaaattgttgatgtcatt
gatacaatcgcctcttaa

DBGET integrated database retrieval system