KEGG   Bacillus subtilis subsp. subtilis 168: BSU29880
Entry
BSU29880          CDS       T00010                                 

Symbol
malS
Name
(RefSeq) NAD-dependent malic enzyme 3
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01200  Carbon metabolism
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU29880 (malS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU29880 (malS)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     BSU29880 (malS)
SSDB
Motif
Pfam: Malic_M malic
Other DBs
NCBI-GeneID: 938071
NCBI-ProteinID: NP_390866
Pasteur: BG12614
BSORF: BG12614
UniProt: O34389 A0A6M3ZFM0
Position
complement(3056849..3058549)
AA seq 566 aa
MKQFRVTNEGDIQTTLRGLEVLSVPFLNKGVAFTEEERKELGLKGFLPPKVLTIDDQAKR
AYEQYSAQPDDLSKNVYLTALHDRNETLFYRLLNDHLGEMLPIVYTPTVGTAIQRYSHEY
RKPRGLYLSIDDPDGMKEAFKQYKDQSDTIDLIVATDAEGILGIGDWGVGGIAISIGKLA
VYTAAAGIDPSRVLAVVLDAGTNQESLLNDPLYVGNQHSRVRGERYDQFIDDYVALARET
FPNALLHWEDFGAKNARSILKRYKDKVCTFNDDIQGTGAVSLAAVLSCAKASKVPLRDHR
VVIFGAGTAGIGIAEQLREALVREGLSEEESYKRFWCIDRNGLLTDDMDQLLDFQKPYAR
SADEVKDYQRNGDGGGIDLLEVVRQAKPTILIGTSTVSGAFTEEIVKEMASHVKRPAILP
MSNPTTLSEAKPEDLIEWTEGRALITTGSPFPPVEYNGVTYHIGQANNALVFPGLGLGTI
VTKSKLITDGMFEACARAIAGMVNVGVPGAPMLPKVEDLRTVSATVAVEVAKTAMKEGVA
TEEPEDIIQAVQDAMWYPVYKPIRAI
NT seq 1701 nt   +upstreamnt  +downstreamnt
gtgaaacaattcagagtaacaaacgaaggagacattcaaacaacattaagaggccttgaa
gtgctctctgttccttttttgaacaaaggtgttgcttttactgaggaagaaagaaaagaa
cttggtttaaaaggctttctgccgcccaaggtattaacaattgatgatcaggcgaaaaga
gcgtatgaacaatattccgcacagcctgacgatttgagcaaaaatgtctatttaacggcg
ctgcacgatcggaatgaaacgctgttttaccgcctgttaaatgaccatttaggggaaatg
ctcccgattgtctacacaccgacagtcggaacggcaattcagagatacagccatgaatac
agaaaaccacgagggctctatctgtcaatcgatgacccggacggtatgaaagaagctttt
aaacagtataaagatcaaagcgatacgatcgatttaattgttgcaactgatgcggaagga
attttaggaatcggtgactggggcgtcggaggaatcgcaatttctattggcaagctggcg
gtttatacagcggctgcgggcattgatccgagcagagtgctggctgttgttttagatgcg
gggacaaatcaggagagcctcttgaacgacccgctttatgtcggcaaccagcattccaga
gtgcgcggggaacgttatgaccaatttattgacgactacgttgcgctggcgagagaaaca
tttccgaatgcattgctgcattgggaggatttcggggcgaaaaacgcgcgaagcattttg
aaacgctataaagataaagtgtgtaccttcaatgatgatatccaaggaactggcgctgtt
tctttggccgcagtcttatcctgtgcaaaagcgtctaaagttccgctgagagatcacaga
gttgttatattcggagcgggaacggcaggaatcggaattgccgaacagctgcgggaagca
ttggtgcgcgagggactgagtgaagaagaatcatacaagcgcttctggtgcatagacagg
aacgggctgttaacagatgatatggatcagcttcttgatttccaaaagccgtatgcccgt
tcggctgatgaagtgaaggattatcagcggaacggagacggcggaggcattgatcttctt
gaagtggttcggcaggcgaaaccgacgatcctgatcggcacatctacggtttccggcgct
ttcactgaagaaattgtaaaagaaatggcgtcacatgtgaaacggccggcgattttgcca
atgtcaaatccgacaactctttctgaagcaaagccggaggatttaatcgaatggacagaa
ggccgtgcgctgatcacgacaggaagcccgttcccgccagttgaatataacggagttacg
tatcatatcgggcaggcaaacaacgcgcttgtcttccctggtctcggtcttggaacgatt
gttacaaaatcaaaattaattaccgacggcatgtttgaagcatgtgcccgggcaatcgca
ggtatggtcaatgtcggggtgcctggggcgccgatgcttccaaaagttgaagatttgcgc
actgtttcggcaaccgttgctgttgaagttgcaaaaaccgcaatgaaggaaggcgtcgct
acggaagagcctgaagacattatacaggcagtgcaggatgcgatgtggtatccggtatac
aaaccgattcgcgcgatataa

DBGET integrated database retrieval system