KEGG   Bacillus subtilis subsp. subtilis 168: BSU29890
Entry
BSU29890          CDS       T00010                                 

Symbol
ytnP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_3
Other DBs
NCBI-GeneID: 937981
NCBI-ProteinID: NP_390867
Pasteur: BG13895
BSORF: BG13895
UniProt: O34760
Position
complement(3058631..3059401)
AA seq 256 aa
MFGVVPKPLWSKKYPVNEKNQIELRTDPILIQKDGLNIIIDAGIGYGKLTDKQKRNYGVT
QESNVKPSLAALGLTVADIDVIAMTHLHFDHACGLTEYEGERLVSVFPNAVIYTSAVEWD
EMRHPNIRSKNTYWKENWEAVAGQVKTFEDTLTITEGITMHHTGGHSDGHSVLICEDAGE
TAVHMADLMPTHAHRNPLWVLAYDDYPMTSIPQKQKWQAFAAEKDAWFIFYHDAEYRALQ
WEEDGSIKKSVKRMKR
NT seq 771 nt   +upstreamnt  +downstreamnt
atgttcggcgttgtgccaaagccgctttggtctaaaaaatatccagtcaatgaaaaaaac
cagattgaactaagaacagaccctattttgattcaaaaggatgggctcaatatcatcatt
gacgccggaattgggtacggcaagctgactgataaacaaaaacgaaactatggcgtgaca
caagagtcgaatgtgaaaccctcattagctgcactcggattaacggttgccgatatagat
gtgatcgcaatgacacaccttcattttgatcatgcatgcggtttaacggaatatgaaggt
gaacggctcgtctctgtctttccgaatgcagtgatttatacatcagctgttgaatgggac
gaaatgcgccatccgaatatcaggtcgaaaaatacgtattggaaagaaaattgggaggct
gtagctggccaagtcaaaacctttgaagacaccttaacgatcacagagggtattacaatg
catcacaccggaggccatagcgacggacacagtgtcctgatatgcgaggatgcgggtgaa
actgccgtacatatggcagatctgatgccgacacatgcccaccgcaatccgctatgggtg
ctggcttacgatgattatccgatgacctctatcccgcaaaagcagaaatggcaggcgttc
gcagcagaaaaagatgcttggtttattttttaccatgatgccgagtatcgcgcccttcaa
tgggaggaggacggaagcatcaaaaagtcagttaagcgaatgaagcgatag

DBGET integrated database retrieval system