KEGG   Bacillus subtilis subsp. subtilis 168: BSU29900
Entry
BSU29900          CDS       T00010                                 

Symbol
trmB
Name
(RefSeq) tRNA (guanine-N(7)-)-methyltransferase
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU29900 (trmB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     BSU29900 (trmB)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    BSU29900 (trmB)
 Prokaryotic type
    BSU29900 (trmB)
SSDB
Motif
Pfam: Methyltransf_4 Methyltransf_12 Methyltransf_25 Methyltransf_31 Methyltransf_11 PCMT
Other DBs
NCBI-GeneID: 936447
NCBI-ProteinID: NP_390868
Pasteur: BG13890
BSORF: BG13890
UniProt: O34522 A0A6M4JMQ2
Structure
PDB: 
2FCA

Position
complement(3059547..3060188)
AA seq 213 aa
MRMRHKPWADDFLAENADIAISNPADYKGKWNTVFGNDNPIHIEVGTGKGQFISGMAKQN
PDINYIGIELFKSVIVTAVQKVKDSEAQNVKLLNIDADTLTDVFEPGEVKRVYLNFSDPW
PKKRHEKRRLTYSHFLKKYEEVMGKGGSIHFKTDNRGLFEYSLKSFSEYGLLLTYVSLDL
HNSNLEGNIMTEYEEKFSALGQPIYRAEVEWRT
NT seq 642 nt   +upstreamnt  +downstreamnt
atgagaatgcgccacaagccttgggctgatgactttttggctgaaaacgcagatattgcc
atcagcaatcctgctgattataaagggaaatggaacacagtgtttggcaacgacaatccg
atccatatcgaggttggtacaggaaaaggccaatttatttctggtatggccaaacaaaat
cccgacatcaattatattggtattgagttatttaaaagcgtcatcgtgacagccgtccaa
aaagtaaaagacagcgaagcgcagaatgtaaagcttctgaatatagatgcggacacgctg
acggatgtgtttgagccgggggaagtgaaacgggtctacttgaacttttctgatccttgg
ccgaagaaacggcatgaaaaacgccgcctgacatattcccacttcctcaaaaaatatgaa
gaagtaatgggcaaaggcggatcgattcattttaaaacggacaaccgaggtttatttgag
tactctttgaagagcttctctgagtacggcctcctgctgacatacgtcagtctcgatttg
cataacagcaatctggaaggcaatattatgacagaatatgaagaaaaattctctgcactc
ggccagccgatctatcgggctgaggttgaatggagaacgtaa

DBGET integrated database retrieval system