KEGG   Bacillus subtilis subsp. subtilis 168: BSU29910
Entry
BSU29910          CDS       T00010                                 

Symbol
ytzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YtzH
Other DBs
NCBI-GeneID: 937298
NCBI-ProteinID: NP_390869
Pasteur: BG13942
BSORF: BG13942
UniProt: O32066 A0A6M3ZFE4
Position
3060395..3060673
AA seq 92 aa
MGLHYEHQVHLLKDILTDHQLDCCGTVAEYEQLERVIKSLMANTELDSNFKNVLEDVYRY
SQSGISSKSIDSHIQEHQNSLSQWVEQMDSYS
NT seq 279 nt   +upstreamnt  +downstreamnt
atgggtttacattatgagcatcaagttcatttattgaaggatatattgactgaccatcaa
ttggactgctgcggaacagtcgcagagtacgagcagcttgagcgtgtgattaaatcactg
atggcaaacaccgagcttgattcaaatttcaaaaacgtgcttgaagatgtttaccgctac
agccaatcaggaatatcgtccaaatccatcgactcacacatacaagagcatcagaacagc
ctgtctcaatgggtagagcaaatggattcgtattcctga

DBGET integrated database retrieval system