KEGG   Bacillus subtilis subsp. subtilis 168: BSU29920
Entry
BSU29920          CDS       T00010                                 

Symbol
ytmP
Name
(RefSeq) phosphotransferase YtmP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: APH Choline_kinase EcKL DUF1679 RIO1 Pkinase TCAD9 DUF3311
Other DBs
NCBI-GeneID: 936622
NCBI-ProteinID: NP_390870
Pasteur: BG13889
BSORF: BG13889
UniProt: C0SPC1
Position
complement(3060674..3061288)
AA seq 204 aa
MENGDVITAQHWMTGRELKPKDMSGRPVAELLRKIHTSKALLDMLKRLGKEPLNPGALLS
QLKQAVFAVQQSSPLIQEGIKYLEEHLHEVHFGEKVVCHCDVNHNNWLLSEDNQLYLIDW
DGAMIADPAMDLGPLLYHYVEKPAWESWLSMYGIELTESLRLRMAWYVLSETITFIAWHK
AKGNDKEFHDAMEELHILMKRIVD
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaaaatggggacgtcattacggcccagcactggatgaccggcagagagctgaagcct
aaagacatgagcggacggcccgttgctgaattgcttcgtaaaatacacacatcaaaagcc
ttgctggacatgctgaagagacttggaaaagaaccgctgaacccgggggctcttttgtct
cagctgaagcaggctgtatttgctgtgcagcaatcttcgccgctgattcaagaagggatc
aagtatttggaagaacacctgcatgaagtgcatttcggtgagaaagtcgtttgccattgt
gatgtcaatcataataactggctattgtctgaagacaaccagctgtatttaattgactgg
gacggcgccatgatcgctgatccggcgatggacctcgggcctttgctgtaccactacgtc
gaaaagccagcttgggagagctggctgagcatgtacggcatagagctgacagaaagcctt
cggttgcgaatggcttggtatgtgttatctgaaacaattactttcattgcctggcataaa
gcaaaaggcaatgataaggaatttcatgatgcaatggaagagctgcatatcctcatgaaa
cgaattgttgattaa

DBGET integrated database retrieval system