KEGG   Bacillus subtilis subsp. subtilis 168: BSU29930
Entry
BSU29930          CDS       T00010                                 

Symbol
amyX
Name
(RefSeq) pullulanase
  KO
K01200  pullulanase [EC:3.2.1.41]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU29930 (amyX)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.41  pullulanase
     BSU29930 (amyX)
SSDB
Motif
Pfam: PulA_N1 CBM_48 Alpha-amylase DUF3372
Other DBs
NCBI-GeneID: 937292
NCBI-ProteinID: NP_390871
Pasteur: BG12566
BSORF: BG12566
UniProt: C0SPA0 A0A6M4JN50
Structure
PDB: 
2E8Y 2E8Z 2E9B

Position
complement(3061651..3063807)
AA seq 718 aa
MVSIRRSFEAYVDDMNIITVLIPAEQKEIMTPPFRLETEITDFPLAVREEYSLEAKYKYV
CVSDHPVTFGKIHCVRASSGHKTDLQIGAVIRTAAFDDEFYYDGELGAVYTADHTVFKVW
APAATSAAVKLSHPNKSGRTFQMTRLEKGVYAVTVTGDLHGYEYLFCICNNSEWMETVDQ
YAKAVTVNGEKGVVLRPDQMKWTAPLKPFSHPVDAVIYETHLRDFSIHENSGMINKGKYL
ALTETDTQTANGSSSGLAYVKELGVTHVELLPVNDFAGVDEEKPLDAYNWGYNPLHFFAP
EGSYASNPHDPQTRKTELKQMINTLHQHGLRVILDVVFNHVYKRENSPFEKTVPGYFFRH
DECGMPSNGTGVGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLLGILDIDTVLYMK
EKATKAKPGILLFGEGWDLATPLPHEQKAALANAPRMPGIGFFNDMFRDAVKGNTFHLKA
TGFALGNGESAQAVMHGIAGSSGWKALAPIVPEPSQSINYVESHDNHTFWDKMSFALPQE
NDSRKRSRQRLAAAIILLAQGVPFIHSGQEFFRTKQGVENSYQSSDSINQLDWDRRETFK
EDVHYIRRLISLRKAHPAFRLRSAADIQRHLECLTLKEHLIAYRLYDLDEVDEWKDIIVI
HHASPDSVEWRLPNDIPYRLLCDPSGFQEDPTEIKKTVAVNGIGTVILYLASDLKSFA
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggtcagcatccgccgcagcttcgaagcgtatgtcgatgacatgaatatcattactgtt
ctgattcctgctgaacaaaaggaaatcatgacaccgccgtttcggcttgagacagaaata
acagattttcctctggctgtcagggaggaatactcccttgaagcaaaatacaagtacgtc
tgcgtatccgaccatcctgtgacatttggaaaaatccattgcgtcagagcatccagcggc
cacaaaacggatctccaaattggcgcggtcatccggacggcagcgtttgatgacgaattt
tattatgacggagagctgggcgccgtttataccgcggatcataccgtatttaaagtatgg
gcgcctgctgcaacctcagctgctgtcaagctttcacaccccaataaaagcgggcgcaca
ttccaaatgactcgcttggaaaaaggcgtctatgccgttacggtcacaggtgaccttcac
ggatatgagtatttgttttgcatctgcaacaattcagaatggatggaaacagttgaccag
tatgccaaggctgtgactgtaaatggagagaagggcgtcgtcttgcgcccggatcaaatg
aaatggactgctcctcttaaaccattctcacaccctgtggatgccgtcatctatgagacg
catcttcgcgacttctccatccatgaaaacagcggcatgataaacaagggaaaatactta
gcgctgacggaaactgatacacaaaccgcaaatggcagttcttcgggattagcgtatgta
aaagagcttggtgtgacacatgtggagcttctgccggtgaatgattttgccggagttgat
gaagagaagccgcttgatgcatacaattggggatataacccgcttcatttctttgccccg
gagggaagctatgcctcaaatcctcatgatcctcaaacgagaaaaacagagctgaaacaa
atgatcaataccctgcatcagcacggtctgcgagtcattctggatgttgtttttaaccat
gtgtataagagggagaattccccctttgaaaagacagtgcccggttattttttccggcac
gacgaatgtgggatgccatcaaacggcaccggcgttggcaatgatattgcatcagaaaga
aggatggcaagaaaattcattgcggattgcgtggtctattggcttgaagaatacaatgtt
gacggcttccgctttgatctcctcgggattttagatattgacaccgtgctttatatgaaa
gagaaagcaactaaggcaaagcccggaatcctgctttttggagaagggtgggacctggct
acaccgctgccgcatgaacagaaagctgctttggcgaacgcgccaagaatgccgggcatc
ggcttttttaatgatatgtttcgtgacgctgtaaaagggaacacctttcaccttaaggca
acagggtttgcgctcggcaacggtgaatcagcacaagctgtgatgcatggaattgccggg
tcttccggatggaaggcattagcaccgattgttccggaaccaagccagtccatcaattat
gtcgaatcacacgacaatcacaccttttgggataaaatgagctttgcgcttcctcaagaa
aatgacagccgaaagcgaagcaggcaaaggcttgcagccgcgattattttgcttgcccaa
ggggtgccgtttattcacagcggccaggaatttttccggacgaagcagggagtggaaaac
agctatcaatccagtgacagcatcaaccagctcgactgggatcgccgtgaaacattcaaa
gaagatgttcactatatccgcaggctgatctcgctgagaaaagcgcatcctgcattccgt
cttaggtccgctgcagacatccagcgccatcttgaatgcttgacgctaaaagaacacctt
atcgcatacaggctttatgatcttgacgaggttgacgaatggaaagatatcattgttatc
catcacgcgagtccagactccgtcgagtggaggctgccaaacgacataccttatcggctt
ttatgtgatccatcaggatttcaggaagacccaacagaaatcaagaaaacggttgcagta
aacggcatcggaacggttatcttatatttagcatcagatcttaagagttttgcttga

DBGET integrated database retrieval system