KEGG   Bacillus subtilis subsp. subtilis 168: BSU29940
Entry
BSU29940          CDS       T00010                                 

Symbol
ytlR
Name
(RefSeq) lipid kinase YtlR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DAGK_cat YegS_C PFK NAD_kinase
Other DBs
NCBI-GeneID: 937289
NCBI-ProteinID: NP_390872
Pasteur: BG13880
BSORF: BG13880
UniProt: O34799 A0A6M4JKZ2
Position
complement(3063833..3064762)
AA seq 309 aa
MSHWFFIINPTAGHRNGLRVWKSIQKELIKRKVEHRSFLTEHPGHAEVLARQISTIQEYK
LKRLIVIGGDGTMHEVVNGLKDVDDIELSFVPAGAYNDFSRGFSIKKIDLIQEIKKVKRP
LTRTFHLGSVNFLQDKSQILYFMNHIGIGFDAYVNKKAMEFPLRRVFLFLRLRFLVYPLS
HLHASATFKPFTLACTTEDETREFHDVWFAVVSNHPFYGGGMKAAPLANPREKTFDIVIV
ENQPFLKKYWLLCLMAFGKHTKMDGVTMFKAKDITFYTKDKIPFHADGEIMGTTPFRLAS
SPSPLRIKT
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagccattggttttttattattaatccgacagcaggacatcgaaacggcctgcgtgtt
tggaagtccattcaaaaagaattgatcaaacgaaaggttgagcaccgttcatttttaact
gaacatccgggacacgccgaggtgctcgccagacagatttcaacgatacaggaatataag
ctgaagcgcctgatcgtcattggcggagacggaaccatgcatgaagttgtcaacgggctg
aaagatgttgacgatattgagctgagctttgtgccggcgggcgcgtataatgatttttcg
cgagggttctctattaaaaaaatcgatctgatacaggaaatcaagaaggtaaagcgcccg
ttaacaagaacctttcatttagggagcgtcaatttccttcaggataaatcacagattctt
tattttatgaatcatatcgggatcgggtttgacgcatatgtcaataaaaaggcgatggaa
tttccgttgagacgggtttttctttttctccgccttcgatttcttgtgtatccgctttct
catttgcacgcttcggcaacctttaagccgtttacattagcttgtacgacggaagacgag
acgcgcgaatttcatgatgtctggtttgccgttgtatccaaccatccgttttacggggga
ggcatgaaggcggcgcccctagcaaatccgcgcgagaagacatttgatatcgtaatcgtt
gaaaaccagccgtttttgaaaaaatattggcttttatgtctcatggcatttggaaaacat
acaaagatggatggcgttacgatgtttaaagcgaaggacattacattttacacgaaggac
aaaatcccgttccatgctgacggagaaatcatgggcactaccccgtttcgtctggcatct
agtccttcacccctaagaatcaaaacataa

DBGET integrated database retrieval system