KEGG   Bacillus subtilis subsp. subtilis 168: BSU29950
Entry
BSU29950          CDS       T00010                                 

Symbol
ytlQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NERD
Other DBs
NCBI-GeneID: 938075
NCBI-ProteinID: NP_390873
Pasteur: BG13879
BSORF: BG13879
UniProt: O34471 A0A6M4JNY3
Position
complement(3064811..3065725)
AA seq 304 aa
MAQIIKIHDYISRYELDPYHYINQFVRLKKERWLSLVEAAERQHEERQASAEEPEPVQKR
KKFSLKRRKEEIKADIQEERHQWFEDEEDIHVRLPKSRVALASFYKRHLYDFQLKWASST
LSEISQLSNQVKQDRILRYLTQQLPDSYFIMYKPVLKIQQAAVELSIVIISPLEIYCVSF
LEAEEDSVYIGSKNRFWDKKTASQTASVLNPGLSLFRTDSVVSKIVKEKQAEIPVRKLLL
SRTSYIDYPEPPYGLEIADKRSAEEWIERQKKNTAPIKHHQVKAAKALLSYCMSDSYRRQ
EWLE
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcacaaatcatcaaaattcatgattatatatcgagatatgagcttgatccgtaccat
tatatcaaccagtttgtacgtttgaaaaaagagcgctggctttcactagtagaagcagcg
gagcgccagcatgaagaaaggcaagccagtgctgaagaaccggaaccggtgcagaaacga
aaaaaattttcattgaaaagaagaaaagaagagataaaagccgatatacaagaagagaga
caccaatggtttgaggacgaagaagatattcatgtaaggctcccgaagagcagggtggcg
cttgcttctttttataaaaggcatttatatgattttcagctcaaatgggcaagctctact
ctttcagaaatatctcaactctcaaaccaagtgaagcaggaccgcattttgcgttatctg
acccagcagctgcctgattcttattttattatgtataagcctgtgctgaaaattcagcag
gcggcggttgaattaagcattgtgattatttctcctctggaaatttattgcgtttctttt
ttagaggctgaggaagacagtgtctacatagggtctaaaaatcgtttttgggacaagaaa
acagcctctcagactgcatcagtgttaaatccagggcttagcctgtttcgtacggactcg
gttgtgtcaaagatcgtaaaggaaaaacaggctgagattccggttcgaaaattgcttctg
agcagaacgtcgtacatcgattacccggagccgccatacggcttagaaatagcggataag
cggagcgcggaagaatggattgagcggcagaagaaaaacactgctccgatcaaacatcat
caggtaaaggctgcaaaggctctattgtcttactgcatgtctgactcctatcgcagacag
gagtggctggagtaa

DBGET integrated database retrieval system