KEGG   Bacillus subtilis subsp. subtilis 168: BSU29970
Entry
BSU29970          CDS       T00010                                 

Symbol
ytkP
Name
(RefSeq) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU29970 (ytkP)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU29970 (ytkP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     BSU29970 (ytkP)
SSDB
Motif
Pfam: PALP ADH_zinc_N SDH_alpha
Other DBs
NCBI-GeneID: 936733
NCBI-ProteinID: NP_390875
Pasteur: BG13872
BSORF: BG13872
UniProt: O34476 A0A6M3ZF59
Position
3066451..3067386
AA seq 311 aa
MLKIVANTADLIGDTPLVRLNRLQPENAAQVYLKLEFFNPSGSVKDRAAYQMIIEAEQNG
LLKPGSVIIEPTSGNTGIGLAMNAAARGYKAILVMPDTMTKERINLLKAYGAEVVLTPGE
ERMPGSIKKAKELAEQIPNSYIPMQFDNTANPDAHRKTTAPEIARAIEEIGKPLGAFVAS
SGTGGTITGTGEALKELFPDITVHVVEPAGSPVLSGGKPGAHKLVGTSPGFIPPILNEDV
YDEIIKISDEDAYTTTRRLAAEEGILVGPSSGAACFAAIETAKRLSPDKVVVCMTADTGE
RYLSTDLWSFI
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttgaaaatcgttgcaaacacagctgatctgataggagatacaccgctagtgagattg
aatcggcttcagccggaaaatgcggcacaagtctatttaaagcttgaatttttcaatccg
agcggcagtgtgaaagacagagccgcttatcaaatgatcatagaagctgaacaaaacggt
ttactcaagccgggatcagttattatagagccgacaagcggaaataccggcatcgggctc
gccatgaatgcggcagcacgcggatataaagcaatcttagttatgcctgatacgatgacg
aaggaacggatcaacctacttaaagcttacggtgcagaggttgtattaactcccggagag
gaaagaatgccgggcagcatcaaaaaagcgaaggagcttgccgaacaaattccgaacagc
tatattccaatgcagttcgataacactgctaatcctgatgcgcaccgaaaaacaacagcg
cctgaaatcgcccgggcaatagaggaaatcggaaaaccgctcggcgcttttgtagcctcc
tctggaacgggcggaaccattaccggaacaggtgaggcgctcaaagagctttttccggat
atcacggttcatgttgttgagccagcgggttcgcctgtattatccggcggaaaacctggc
gcgcataaacttgtaggaacgagcccaggctttataccgccgattttaaatgaagacgtt
tatgatgaaattatcaaaatctctgatgaagacgcgtatacgacgacaagacggcttgct
gctgaagaaggaattcttgtcggtccttcatcaggcgctgcctgcttcgcggcaatcgaa
acagcgaaacgcctctctcctgacaaagttgtggtctgcatgacagctgatacaggagaa
cggtacttatcaactgatttatggtcatttatttaa

DBGET integrated database retrieval system