KEGG   Bacillus subtilis subsp. subtilis 168: BSU29990
Entry
BSU29990          CDS       T00010                                 

Symbol
pbuO
Name
(RefSeq) guanine/hypoxanthine permease PbuO
  KO
K06901  adenine/guanine/hypoxanthine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU29990 (pbuO)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU29990 (pbuO)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-GeneID: 938070
NCBI-ProteinID: NP_390877
Pasteur: BG13864
BSORF: BG13864
UniProt: O34978 A0A6M3ZFL9
Position
3068908..3070206
AA seq 432 aa
MFHLKEQQTSIKQEIIAGLTTFFTMVYIVVVNPVILANAGVPFDQVFTATIIASIVGTLW
MALAANYPIAIAPGMGLNAYLAFHVVSASDGGITYATAFSAVFTAGVLFIILSLTPLRKQ
LIEAIPNNLKYGITTGIGLFIAFIGLRQAGIVAADESNLVTLGNLHSPGVILTLVGLLIS
VVLMVLNVSGALFIGMAATALIAFFTGQLHFSKGFMSLPHLPEGLMISNPFTAFGDVIHH
GLYAVVFSFLLVTIFDTTGTMIGVAEQAGLMKNNKLPNVRKALLADSTATTVGAVFGTSP
TTAFIESSAGVAAGGRTGLTALTVAVMFAASMFFSPLVSALSGIAAITSPALIIVGSLMM
GSVSNMNWKEMDEAFPAFLVILAMPLTSSISTGIALGFISYPIVKAARGKWREIHPLVIV
FAILFFIQLFIL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtttcatctaaaagagcagcaaacatccataaagcaagaaatcatagcagggctgacg
acctttttcacaatggtctatatcgtcgtggtcaatccggtcattctggctaacgccggg
gttcctttcgaccaggttttcaccgcaacgattattgcctccattgtcggaacgctgtgg
atggccctggcagcaaattatccgattgctattgcgcccggcatgggcttgaacgcttat
ttagcctttcatgtcgtaagcgcaagcgatggcggcatcacgtacgcaacagctttcagc
gcagtatttacagcaggggttctcttcattattctatcgttaacgcctttaagaaaacaa
cttatagaagcgattccaaacaatttaaaatacgggatcacaacagggatcgggctgttt
attgcttttatcggtttgcgtcaagcgggaattgtggcagctgatgagtcaaacctggtc
actctcggcaatctgcattcacctggtgttatcttaacgctggtcggccttttgatcagc
gtggtcctgatggtgctgaatgtaagcggcgctttatttatcggaatggcagctaccgct
ttgatcgcctttttcaccggtcagctccatttttcaaagggatttatgtcgcttcctcat
ttgccggaaggattgatgatctcaaatccatttaccgcttttggcgatgtcattcatcac
ggcctgtacgctgtcgtcttttcttttctattagtcaccatttttgatacgacaggcacg
atgatcggagttgccgagcaagccgggctgatgaaaaacaacaagctgccgaacgtgcga
aaagcgctgcttgctgattcaaccgcgacgacagtaggagctgttttcggcacaagtccg
acgactgcatttatcgagtcttccgccggtgtcgcagccgggggaagaacggggcttacg
gctttgactgtcgcggtgatgtttgcggcttcaatgtttttcagtccgcttgtcagcgcc
ttgtcaggtatagccgccatcacctcgcctgctttgattatcgtcggcagcctgatgatg
ggctcagtttccaatatgaactggaaagagatggacgaggcatttcctgcgtttctcgtc
attctagccatgcctttgacctcgagcatttctacaggaatcgcgcttggctttatttcg
tacccaattgtaaaagcggcgcggggaaaatggagagagattcatccgctcgtcatcgtt
ttcgccattctgtttttcatccagctgtttattttataa

DBGET integrated database retrieval system