KEGG   Bacillus subtilis subsp. subtilis 168: BSU30000
Entry
BSU30000          CDS       T00010                                 

Symbol
ythQ
Name
(RefSeq) transporter
  KO
K01992  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30000 (ythQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU30000 (ythQ)
SSDB
Motif
Pfam: EcsB DUF4481
Other DBs
NCBI-GeneID: 937288
NCBI-ProteinID: NP_390878
Pasteur: BG13861
BSORF: BG13861
UniProt: O35029 A0A6M4JMR0
Position
complement(3070246..3071403)
AA seq 385 aa
MNGRTLFFRRLFDYYKYQFKVLHAVIDWTVALYIVLPAIAFVIYQYIDLMNGRGLLYEWS
EVAEWRWLYAVCVLIMFTGSIRTFLMEADKVFLLQKKEIIYQLKRYALLYSFLATLAKWL
LLFFIVLPLISHSVLITFAESTALLCYLFGLHIFFLSLKQDRIRKPRSISRWIGDTLVRA
ILFAGSAILIVFTERHLLALFGILFLFFSVIRSLKKTASFTAFEAEVTEEKKSRLALAGL
VMMMSQEAGMPKVKDRMRRKPLLYRNSKRIFKRRTICTGYKELFFKVMLRNGEYARQMYM
LLSAFTVLIFVSPIWLKVIALLVYTGVCRYILTLIFDKVMDAPFLIGTDKESDEYYRARK
SCINILHYAFAACCFLAAAVSLLFT
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaacgggcgtacgctcttttttcgaaggctgtttgactattataagtatcagtttaaa
gtgttgcatgcggtcattgactggacagtcgctctctatatcgttttgccggcgattgct
tttgtcatctatcagtatattgatttgatgaacggaagaggccttctttatgagtggtct
gaagtggcggaatggagatggctgtatgctgtgtgtgtgctgatcatgtttacaggttcg
attcgtacatttttaatggaagcggacaaagtgtttttgctgcaaaagaaggaaatcatc
tatcagctcaaacggtatgcgcttttgtattcttttctggccacgctggctaaatggctg
cttctctttttcattgtccttcccttgatcagtcattctgttctcatcacattcgcagaa
agcactgctctattgtgttatttgtttggccttcatatattctttttatccttaaagcaa
gacaggatcagaaagccgcgctccatttcgagatggattggcgatacccttgtcagagct
attctttttgctggttctgctatcctgattgtttttactgagcggcacttgcttgcgctt
tttggcattttatttttgtttttctcagttatccgcagtttgaaaaagacagcctcgttc
acggcttttgaagctgaggtgactgaagagaaaaaaagcaggcttgcccttgcaggactt
gtgatgatgatgagtcaggaggcgggaatgccaaaagtaaaagacaggatgagaagaaaa
ccattattataccgaaattcaaaaaggatatttaaaagacgaacgatctgcacaggctat
aaggagttgttttttaaagttatgctgaggaatggcgagtatgcaaggcagatgtacatg
ctactgtcagctttcactgttctcatatttgtttccccaatttggctgaaggtgattgcg
ctgctggtatacacaggggtttgccgttatatcctgacgcttatttttgacaaggtcatg
gatgccccttttttaattggcaccgataaggaaagtgatgaatattatcgggccagaaaa
agctgtatcaacatcctgcactatgcgtttgccgcctgttgttttttagcggccgctgtc
tctttattgtttacataa

DBGET integrated database retrieval system