KEGG   Bacillus subtilis subsp. subtilis 168: BSU30010
Entry
BSU30010          CDS       T00010                                 

Symbol
ythP
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30010 (ythP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU30010 (ythP)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 MeaB AAA_23 AAA_27 DUF815 AAA_16 MMR_HSR1 AAA_30
Other DBs
NCBI-GeneID: 937282
NCBI-ProteinID: NP_390879
Pasteur: BG13860
BSORF: BG13860
UniProt: O34977 A0A6M3ZFF5
Position
complement(3071400..3072110)
AA seq 236 aa
MTNLLEASIEQAGYTSRKKVLTDVFLEVRKGELVGLIGANGAGKSTAIKAILGLSEDFKG
HIAWNDCSFAYIPEHPSFYEELTLWEHLDLISTLHGIEESEFAHRAQSLLQTFSLDHVKH
ELPVTFSKGMQQKLMLIQAFLSKPDMYVIDEPFIGLDPISTKRFVDMLKAEKERGAGILM
CTHVLDTAEKICDRFYMIEKGSLFLQGTLKDVQDKTGLEGQSLLDCFYKAVQGDRL
NT seq 711 nt   +upstreamnt  +downstreamnt
ttgacaaatttgcttgaagcttcaatagaacaggccgggtatacaagccgaaaaaaagtg
ctcaccgatgtttttctggaagtcagaaaaggggaactggttggactgatcggagctaac
ggcgcaggaaaaagcaccgcaatcaaggcgatactcggcctttcagaagattttaaaggg
catattgcctggaacgactgttcatttgcatatattccggagcatccgtccttctacgaa
gaactgacgctgtgggagcatttggatctgatcagcacacttcacggcattgaagagagt
gaatttgcgcatcgggcccaaagcctgctgcagacgttttcgctagatcatgtcaaacat
gagctgcctgtcaccttttcgaagggcatgcagcaaaaactaatgcttatccaggccttt
ctctctaagccggatatgtatgtgattgatgaaccgtttatcggccttgatccgatatcg
acgaaacgctttgtggacatgcttaaggctgaaaaagaacgtggagccggaattcttatg
tgcacgcatgtactcgataccgcggaaaaaatctgtgaccggttttatatgattgagaaa
ggttcattatttctccaaggcacgttaaaagatgttcaggacaagaccggattagagggg
cagtcattgcttgactgtttttataaggcagttcaaggtgatcggctatga

DBGET integrated database retrieval system