KEGG   Bacillus subtilis subsp. subtilis 168: BSU30020
Entry
BSU30020          CDS       T00010                                 

Symbol
ytzE
Name
(RefSeq) DeoR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_DeoR HTH_11 HTH_PafC Fe_dep_repress HTH_23 HTH_5 GntR DUF4423 AbiEi_4 MarR_2 Rrf2
Other DBs
NCBI-GeneID: 937281
NCBI-ProteinID: NP_390880
Pasteur: BG13939
BSORF: BG13939
UniProt: O32067 A0A6M3ZFC6
Position
3072401..3072622
AA seq 73 aa
MKPSTNRMLTRIKSVYMFIQEKGLVTTQELVDEFGITPRTIQRDLNVLAYNDLVHSPSRG
KWETTRKKVKITS
NT seq 222 nt   +upstreamnt  +downstreamnt
ttgaaaccttcaacaaaccgtatgctaactcgaatcaaatcagtttacatgtttattcaa
gaaaaaggtcttgtgacaacacaggaactggttgacgaattcggcattacacctagaacg
attcaaagagacttaaatgtgttggcatataatgatcttgttcatagtccaagccgtggc
aagtgggagacaacgagaaagaaagtaaagattacctcataa

DBGET integrated database retrieval system