KEGG   Bacillus subtilis subsp. subtilis 168: BSU30035
Entry
BSU30035          CDS       T00010                                 

Symbol
ytzG
Name
(RefSeq) 16S rRNA pseudouridine(516) synthase
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU30035 (ytzG)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     BSU30035 (ytzG)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BSU30035 (ytzG)
SSDB
Motif
Pfam: PseudoU_synth_2 S4
Other DBs
NCBI-GeneID: 936165
NCBI-ProteinID: NP_390882
UniProt: O32068 A0A6M3ZIK3
Position
complement(3072743..3073462)
AA seq 239 aa
MRLDKLLANSGYGSRKEVKAVVKAGAVMIDGKPAKDVKEHVDPDTQEVTVYGEPVDYREF
IYLMMNKPQGVLSATEDSRQQTVVDLLTPEEMRFEPFPAGRLDKDTEGFLLLTNDGQLAH
RLLSPKKHVPKTYEVHLKSQISREDISDLETGVYIEGGYKTKPAKAEIKTNDSGNTVIYL
TITEGKYHQVKQMAKAVGNEVVYLKRLSMGRVSLDPALAPGEYRELTEEELHLLNEPQA
NT seq 720 nt   +upstreamnt  +downstreamnt
atgagacttgataagctgcttgccaacagcgggtatggttccagaaaagaagtcaaagcc
gttgtgaaggctggagccgtgatgatcgacggcaaacctgccaaagatgtaaaggagcac
gttgatcctgatacgcaggaggtgaccgtatacggggaaccggttgattatcgagagttc
atttatcttatgatgaataaaccgcagggcgtgctgtcggcgactgaggacagccggcag
caaacagtggtcgatctgctgacgccggaggagatgagatttgagccatttccagccggc
aggcttgataaagatacagagggctttttgctgctcacaaatgacggccagctcgcacat
cggctcctttctcctaaaaagcatgttccaaaaacgtatgaagtccatttaaaatcacag
atttctcgggaagacatttccgatttggaaacgggtgtctacatagagggcggctataaa
acaaagccggcaaaagcggaaatcaaaacaaacgacagtggcaataccgttatatatctg
acaattacagaaggaaaataccatcaggtcaagcaaatggcaaaggcagtcggcaatgaa
gtggtttatctgaagcggctttcgatgggacgcgtttccctagatcccgctctggcaccc
ggagaataccgtgagctgacagaggaagagcttcatttgctaaatgagccgcaagcatga

DBGET integrated database retrieval system