KEGG   Bacillus subtilis subsp. subtilis 168: BSU30050
Entry
BSU30050          CDS       T00010                                 

Symbol
ytgP
Name
(RefSeq) cell division protein YtgP
  KO
K03328  polysaccharide transporter, PST family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU30050 (ytgP)
SSDB
Motif
Pfam: Polysacc_synt Polysacc_synt_C MurJ MatE
Other DBs
NCBI-GeneID: 937937
NCBI-ProteinID: NP_390883
Pasteur: BG13856
BSORF: BG13856
UniProt: O34674 A0A6M4JL03
Position
complement(3073531..3075165)
AA seq 544 aa
MSSKLLRGTFVLTLGTYISRILGMVYLIPFSIMVGATGGALFQYGYNQYTLFLNIATMGF
PAAVSKFVSKYNSKGDYETSRKMLKAGMSVMLVTGMIAFFILYLSAPMFAEISLGGKDNN
GLTIDHVVYVIRMVSLALLVVPIMSLVRGFFQGHQMMGPTAVSQVVEQIVRIIFLLSATF
LILKVFNGGLVIAVGYATFAALIGAFGGLVVLYIYWNKRKGSLLAMMPNTGPTANLSYKK
MFFELFSYAAPYVFVGLAIPLYNYIDTNTFNKAMIEAGHQAISQDMLAILTLYVQKLVMI
PVSLATAFGLTLIPTITESFTSGNYKLLNQQINQTMQTILFLIIPAVVGISLLSGPTYTF
FYGSESLHPELGANILLWYSPVAILFSLFTVNAAILQGINKQKFAVVSLVIGVVIKLVLN
VPLIKLMQADGAILATALGYIASLLYGFIMIKRHAGYSYKILVKRTVLMLVLSAIMGIAV
KIVQWVLGFFISYQDGQMQAAIVVVIAAAVGGAVYLYCGYRLGFLQKILGRRLPGFFRKG
RHAG
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaagcaaactgttaagaggcacgtttgtattaacgctcggtacatatatatcgcgg
attctggggatggtctatttaattcccttcagcattatggtcggggcgacaggcggtgca
ttatttcaatacggatacaaccaatacactttatttttgaatattgctacgatgggcttt
ccggccgctgtttctaaatttgtttccaaatataattcaaaaggggattatgagacaagc
aggaaaatgctcaaggcgggcatgtcggttatgctagtcacaggaatgatagcctttttc
attctgtatctatcggctccgatgtttgcggaaatatcgctgggaggcaaggataataac
ggcctgacaattgatcatgtcgtttatgtcatccgcatggtcagcttagcgcttttggtc
gtaccgattatgagccttgtccgcggattctttcaagggcaccaaatgatgggtccgaca
gctgtttcccaagtcgttgaacagattgtccgcatcatctttctattgagtgcgacattc
ttgattttgaaggttttcaacggcggccttgtcatcgctgtgggctatgcaaccttcgca
gcgctgatcggtgccttcggagggctggtcgtgctttatatttattggaacaaacggaag
ggcagcctgctggcgatgatgccgaatacgggtccgacagcaaacctaagctacaagaaa
atgtttttcgagctgttcagctatgctgctccgtacgtttttgtcggactagccatccct
ttgtataactatattgatacaaatacgtttaacaaagcgatgattgaagccggtcatcaa
gccatcagccaggacatgcttgcgattctaaccctgtatgttcagaagctcgtgatgatc
ccggtttccctagcaactgcttttggactgacattaattccaacgattactgaatcgttt
acaagcggaaactataagctgttaaatcagcagattaatcaaacgatgcagacgatcctg
tttttaattattccggctgttgtcgggatctctctattgtcaggaccgacgtatacgttc
ttttacgggtcagagagccttcatcctgaactgggggcaaacattttgctttggtattcg
cctgtcgcaattctgttctctttgtttacagtcaacgcagctattctgcagggcatcaat
aagcaaaaatttgcggttgtcagccttgtgatcggtgtcgtgatcaagcttgtgctgaat
gttccgctgatcaagctgatgcaggctgacggagcgattttagcgacggcgcttggatat
atcgcttcccttttatatgggtttatcatgattaagcgccatgcaggctattcgtataag
atacttgttaaacgaactgttttgatgctggtcttatcagccattatgggtattgccgtg
aaaatcgtgcagtgggtattaggcttctttatttcctatcaggatggccagatgcaagct
gcgattgttgtggtgatcgcggccgctgttggcggagctgtctacctgtattgcggctac
cgattaggatttttgcagaaaattttaggccgccgtttgccaggtttctttaggaaaggc
agacatgcaggctga

DBGET integrated database retrieval system