KEGG   Bacillus subtilis subsp. subtilis 168: BSU30060
Entry
BSU30060          CDS       T00010                                 

Symbol
ytfP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HI0933_like FAD_binding_2 GIDA FAD_oxidored Pyr_redox_2 DAO Pyr_redox_3 FAD_binding_3 Pyr_redox NAD_binding_8 Thi4 NAD_binding_9 Lycopene_cycl AlaDh_PNT_C Trp_halogenase
Other DBs
NCBI-GeneID: 937280
NCBI-ProteinID: NP_390884
Pasteur: BG13850
BSORF: BG13850
UniProt: Q795R8 A0A6M3ZIJ8
Position
3075367..3076629
AA seq 420 aa
MKQYDVIVIGGGPSGLMAAIAAGEQGAGVLLIDKGNKLGRKLAISGGGRCNVTNRLPVEE
IIKHIPGNGRFLYSAFSEFNNEDIIKFFENLGIQLKEEDHGRMFPVTDKAQSVVDALLNR
LKQLRVTIRTNEKIKSVLYEDGQAAGIVTNNGEMIHSQAVIIAVGGKSVPHTGSTGDGYE
WAEAAGHTITELFPTEVPVTSGEPFIKQKTLQGLSLRDVAVSVLNKKGKPIITHKMDMLF
THFGLSGPAILRCSQFVVKELKKQPQVPIRIDLYPDINEETLFQKMYKELKEAPKKTIKN
VLKPWMQERYLLFLLEKNGISPNVSFSELPKDPFRQFVRDCKQFTVLANGTLSLDKAFVT
GGGVSVKEIDPKKMASKKMEGLYFCGEILDIHGYTGGYNITSALVTGRLAGLNAGQYARS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaaacaatatgacgtaatcgtaatcggcggaggcccttcaggcttgatggctgcgatt
gcagcaggagaacagggcgctggcgtgttgctgatagataaaggaaataaattaggacgg
aaactcgcgatttccgggggcggccgctgcaatgtgacgaaccgccttcctgtggaagaa
attatcaagcacatccccggcaacgggcgttttttatacagcgcgttttctgaatttaat
aatgaggacattatcaagttttttgaaaacctcggcattcaattgaaggaagaggatcac
ggccggatgtttcctgtgaccgacaaagcccaaagtgtcgttgacgcgctgttaaacagg
ctaaagcagctccgcgtaacaatcagaacgaacgagaaaattaaatctgttttatatgaa
gatggacaggcagcagggattgtgacgaataatggcgaaatgatccatagccaggcagtc
attattgctgtcggcggtaaaagcgtgcctcataccggaagcacgggagacggctatgaa
tgggctgaagccgcgggccataccataacagagctgtttccgacagaggttcccgtcact
tctggcgaaccgttcattaagcaaaaaacacttcagggcttatcactaagagatgtagcc
gtcagtgtgttaaataaaaaaggcaaaccgattatcacacataaaatggacatgctgttt
acccatttcggcctctcaggacctgccattctcagatgcagccaatttgtcgtaaaagag
ctgaaaaaacagcctcaagtgccgatcagaatcgacttgtatccggatatcaatgaagaa
acgcttttccaaaagatgtataaagaactgaaggaagcaccgaaaaaaaccattaaaaac
gtgctgaagccttggatgcaggagcgctatctcctattcctgctcgaaaaaaacggcatc
tctccgaacgtatcgttttctgagctgccgaaggatcctttcagacaatttgtaagggac
tgcaagcagtttactgtcctcgcaaatggcacactgtcgcttgataaggcatttgtcacg
ggaggcggggtatctgtaaaagaaattgacccgaaaaagatggcttctaaaaaaatggag
gggctttatttttgcggtgaaattctggatatccacggctacacaggcggatacaatatt
acctccgcccttgtcacaggcaggcttgcagggctaaatgccgggcaatacgcccgttct
taa

DBGET integrated database retrieval system