KEGG   Bacillus subtilis subsp. subtilis 168: BSU30070
Entry
BSU30070          CDS       T00010                                 

Symbol
opuD
Name
(RefSeq) glycine betaine transporter OpuD
  KO
K05020  glycine betaine transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30070 (opuD)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU30070 (opuD)
SSDB
Motif
Pfam: BCCT
Other DBs
NCBI-GeneID: 937986
NCBI-ProteinID: NP_390885
Pasteur: BG11958
BSORF: BG11958
UniProt: P54417 A0A6M4JNY4
Position
3076818..3078356
AA seq 512 aa
MLKHISSVFWIVIAITAAAVLWGVISPDSLQNVSQSAQAFITDSFGWYYLLVVSLFVGFC
LFLIFSPIGKIKLGKPDEKPEFGLLSWFAMLFSAGMGIGLVFYGAAEPISHYAISSPSGE
TETPQAFRDALRYTFFHWGLHAWAIYAIVALCIAYFQFRKGAPGLISSTLSPILGDKVNG
PIGKAIDCIAVFATVVGVSTSLGLGATQINGGLNYLFGIPNAFIVQLVLIIIVTVLFLLS
AWSGLGKGIKYLSNTNMVLAGLLMLFMLVVGPTVLIMNSFTDSIGQYIQNIVQMSFRLTP
NDPEKREWINSWTIFYWAWWISWSPFVGIFIARVSRGRTIREFLIGVLVTPCILTFLWFS
IFGVSAMDLQQKGAFNVAKLSTETMLFGTLDHYPLTMVTSILALILIAVFFITSADSATF
VLGMQTSYGSLNPANSVKLSWGIIQSAMAAVLLYSGGLAALQNTAILAALPFSIVILLMI
ASLYQSLSKERREIKKAEKLDKPRSPRVKKAY
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgttgaaacatatatctagtgtattttggattgtgattgcaatcacagctgcagctgta
ttatggggtgttatttctcctgacagcctgcaaaatgtgtctcaatcggcacaagcattt
attaccgattcatttggttggtattatcttttagttgtctctttgtttgtcgggttttgt
ctctttttgattttcagcccgatcggaaaaatcaaactcggaaagcctgatgaaaaaccg
gaattcgggttattatcatggtttgccatgctgttcagcgcaggcatgggaatcggctta
gtattctacggtgcggctgaaccgatcagccattacgcaattagctctccatcaggtgaa
acagaaaccccccaagccttcagagatgcactccgctatacgtttttccactggggtttg
cacgcttgggccatttatgccattgtggcattatgcattgcctatttccaattccgcaaa
ggcgcacccgggttaatcagcagcacactgtcaccgattctcggggataaagtaaacgga
ccgatcggaaaggccattgactgtattgcagttttcgccactgttgtcggggtgtcaaca
agtcttggtcttggcgcaacccaaattaacggcggtttgaattacctgttcggcattccg
aatgcgtttatcgtccaattggttttaatcattattgtgacagtgctctttttactttct
gcgtggagcggactcggaaaaggaattaagtatttaagcaacacaaacatggtattggcc
ggattgttaatgttgtttatgctcgttgtcgggcctacagtgctgataatgaactcattt
acagattctatcggacaatacattcaaaatatcgttcaaatgagcttcagactgacaccg
aacgatcctgaaaaacgcgaatggattaacagctggacgattttctattgggcatggtgg
atttcctggtctccatttgtcggcattttcatcgcccgtgtatccagaggccggacgatc
cgcgaatttttaatcggcgtcttggtgacaccttgtattttgacatttctatggttctcc
attttcggcgtatcagccatggatctccagcaaaaaggcgcgttcaatgtagcaaagctg
tccactgaaacgatgctgttcggaacacttgatcactatccgctgacaatggtgacatcg
atccttgcattgattctgatcgcagtattctttatcacgtcagctgattcagctacattc
gtgctgggcatgcagacgtcgtacggttctttaaatccggcgaattctgtgaaactcagc
tggggtatcattcagtccgccatggcggctgtgctcctatattccggagggcttgccgct
ttgcagaacacagcgattctggcagcgctgccgttttctatcgttatcctgctgatgatt
gcctctctctatcaatcgctctcaaaagaaagaagagagatcaaaaaagcggagaaactc
gataaaccaagaagtccaagagtgaaaaaagcatattaa

DBGET integrated database retrieval system