KEGG   Bacillus subtilis subsp. subtilis 168: BSU30080
Entry
BSU30080          CDS       T00010                                 

Symbol
yteV
Name
(RefSeq) sporulation protein cse60
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Spore_Cse60
Other DBs
NCBI-GeneID: 937278
NCBI-ProteinID: NP_390886
Pasteur: BG12339
BSORF: BG12339
UniProt: P94496 A0A6M3ZFV4
Position
complement(3078393..3078575)
AA seq 60 aa
MLKVAVFDEEHEKDLQTEINSFLKGISEEQLIDIKYTVSAACDPDGEQLYCFSALILYRK
NT seq 183 nt   +upstreamnt  +downstreamnt
atgctgaaggtagcggtatttgatgaagagcatgaaaaagacttacaaacggaaatcaat
tcatttttaaaagggatatcggaggagcagctgatagatatcaaatatacggtttcggcg
gcgtgcgacccagacggcgagcagctttactgtttttccgcccttattttatatcgcaaa
taa

DBGET integrated database retrieval system