KEGG   Bacillus subtilis subsp. subtilis 168: BSU30090
Entry
BSU30090          CDS       T00010                                 

Symbol
yteU
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF624
Other DBs
NCBI-GeneID: 936405
NCBI-ProteinID: NP_390887
Pasteur: BG13846
BSORF: BG13846
UniProt: O34378 A0A6M4JKK7
Position
complement(3078643..3079311)
AA seq 222 aa
MEHDGSLGRMLRFCEWIMRFAYTNLLWLFFTLLGLGVFGIMPATAALFAVMRKWIQGQDN
VPVLKTFWQEYKGEFFRSNLLGAVLALIGVIIYIDLALIYPSHFLLHILRFAIMIFGFLF
VSMLFYVFPLLVHFDWKKRLYVKFSLLLSVAYLQYTLTMLALTVALFFLLAYLPGIVPFF
SVSLISYCHMRIVYAVLLKVEQHGGEPQRKSHIRKAFYPETR
NT seq 669 nt   +upstreamnt  +downstreamnt
atggaacatgatggctcactgggacggatgctgcgtttttgcgaatggattatgagattt
gcgtatacaaacttgctgtggctgttttttacgttgctcggtctcggcgtgtttggcatc
atgcccgcgaccgcggctttattcgctgtcatgcggaagtggatccaggggcaggacaac
gttccggtgctcaaaacgttttggcaggaatacaagggtgaattttttcgttcaaatctg
ctcggcgctgtactggcgctcatcggagtgatcatttatattgatttggccttaatttat
ccaagtcatttccttctgcacatcctgcgcttcgccattatgatatttggctttttgttc
gtatccatgcttttttatgtgtttccgctgcttgtccattttgactggaaaaaacgtctg
tatgtgaaattttcgctcttgctcagtgtggcgtatttgcaatatacgcttactatgctt
gcgctgactgttgctctctttttcttgcttgcgtacctgccgggcattgtcccttttttc
agcgtcagccttatcagctactgccatatgcgcattgtttatgccgtgctgctgaaagtg
gagcagcacggcggcgagccacagaggaaatcccatatacggaaagctttttatccggaa
acgagataa

DBGET integrated database retrieval system