KEGG   Bacillus subtilis subsp. subtilis 168: BSU30100
Entry
BSU30100          CDS       T00010                                 

Symbol
yteT
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA
Other DBs
NCBI-GeneID: 937274
NCBI-ProteinID: NP_390888
Pasteur: BG13845
BSORF: BG13845
UniProt: O34371 A0A6M3ZFN9
Position
complement(3079333..3080619)
AA seq 428 aa
MKNIVFCGLSSRAFSMFIKPLMERFSTHYEITGLLDADPKRFAVCKKKFPELAHVPEFSE
DAFDEMMRVSKPDIVIVAGRDDTHVAYIVKSLQWNTDVITEKPMVTTVQDANRVLEAEAK
SEGKVTVAFNYRYSPFHRKIKEMILDGKIGRVTSVDLNWYIDTYHGASYFKRWNRSRQFS
GGLSVHKSTHHFDLVNWWLGQNPEEVFAYGALNYYGPDSEWNPLPEEDGRFCGTCRVKEK
CHYYSRWHPRSSKASIKDDHLEAGDQSSLYTAYRPDACIFDEEIDIEDTYVAAVKYDGGA
LLSYSIIFSAPYEGYRLTINGTKGRIESNEFHEPSRIPFAFPEQTIEYYPLFESKQTIQV
VKNEGGHGGGDPLLLEDLFLGKDPLRRYDILAGAEAGAYSIAVGEGMWRSVAEKKPIGMK
ELFQMQNV
NT seq 1287 nt   +upstreamnt  +downstreamnt
ttgaagaacatcgtcttttgcggattgagcagcagagcattcagtatgtttatcaaacca
ctgatggagcggttttcaactcattatgagattacgggattgctggatgccgatccgaaa
cgttttgccgtttgcaagaagaaatttcccgagctggcccacgtgcctgagtttagcgaa
gatgcttttgacgagatgatgcgcgtctcaaagcctgatatcgtcattgtggcaggcagg
gacgatacgcatgtcgcatatattgtaaaaagccttcagtggaatacagatgtgattact
gaaaaaccaatggtgacaacagtgcaggatgcgaatcgggtgcttgaagcggaggccaaa
agcgaaggaaaagtcaccgtcgcgtttaactatcgctacagcccgtttcatcggaaaata
aaagaaatgattctggacggaaaaataggcagggtcacttctgttgatttaaattggtat
attgatacgtatcatggcgccagctattttaaacgctggaacaggtcgagacagttttcc
ggcggtctttctgtccataaatcaacacatcacttcgatctcgtcaattggtggctcggg
caaaatccggaagaggtatttgcttatggcgccttgaattactatgggccggacagtgag
tggaaccccttgccggaagaagacgggcgtttttgcgggacgtgccgtgttaaagaaaaa
tgccactactattcaaggtggcatccccgttcctctaaagcttctataaaggatgatcat
cttgaagcaggagaccagtccagcttatatactgcatacaggcctgacgcgtgtattttt
gacgaggaaattgacatcgaggatacgtacgtggcggcagtcaaatatgatggcggcgca
ctgttaagctactcgattattttttcggccccgtatgaaggctaccggctgacgatcaac
ggcacaaaaggacgtattgaatcaaatgaatttcacgaaccttccagaattccgtttgct
tttcctgagcagacaatcgaatactatccgctttttgaatcaaagcagacgatacaagtg
gtcaaaaatgaaggggggcatggcggaggtgatccgcttttgcttgaggatcttttttta
gggaaagacccgctgcgccgctatgatattttagccggggctgaagctggagcctactcc
atcgcggttggtgagggaatgtggcgctcggttgccgaaaagaagccgatcggcatgaaa
gagctttttcagatgcagaatgtataa

DBGET integrated database retrieval system