KEGG   Bacillus subtilis subsp. subtilis 168: BSU30120
Entry
BSU30120          CDS       T00010                                 

Symbol
yteR
Name
(RefSeq) rhamnogalacturonyl hydrolase
  KO
K15532  unsaturated rhamnogalacturonyl hydrolase [EC:3.2.1.172]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU30120 (yteR)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.172  unsaturated rhamnogalacturonyl hydrolase
     BSU30120 (yteR)
SSDB
Motif
Pfam: Glyco_hydro_88 Glyco_hydro_127 C5-epim_C Glyco_hydro_76 ADI
Other DBs
NCBI-GeneID: 937273
NCBI-ProteinID: NP_390890
Pasteur: BG13843
BSORF: BG13843
UniProt: O34559 A0A6M3ZF64
Structure
PDB: 
1NC5 2D8L 2GH4

Position
complement(3081131..3082243)
AA seq 370 aa
MDQSIAVKSPLTYAEALANTIMNTYTVEELPPANRWHYHQGVFLCGVLRLWEATGEKRYF
EYAKAYADLLIDDNGNLLFRRDELDAIQAGLILFPLYEQTKDERYVKAAKRLRSLYGTLN
RTSEGGFWHKDGYPYQMWLDGLYMGGPFALKYANLKQETELFDQVVLQESLMRKHTKDAK
TGLFYHAWDEAKKMPWANEETGCSPEFWARSIGWYVMSLADMIEELPKKHPNRHVWKNTL
QDMIKSICRYQDKETGLWYQIVDKGDRSDNWLESSGSCLYMYAIAKGINKGYLDRAYETT
LLKAYQGLIQHKTETSEDGAFLVKDICVGTSAGFYDYYVSRERSTNDLHGAGAFILAMTE
LEPLFRSAGK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggatcaatcaatcgctgtaaaatcgcctcttacgtacgcggaggcattggcaaacacc
attatgaacacgtacacagtcgaggagctgccacctgcaaaccgctggcactaccatcag
ggtgttttcttatgcggtgtattgcggctgtgggaagcaaccggggaaaagcggtatttt
gagtatgcgaaggcttatgcagatctcttaatcgatgataatggcaatctattatttaga
agagatgaactggacgccattcaagcaggtctcattctttttccattatacgagcagacg
aaggatgaacggtatgtcaaagcggcaaaaaggctgcgcagcttatatggaacactgaac
cggacgtctgagggcggtttttggcacaaagacggttatccttaccaaatgtggcttgac
ggcttatacatgggggggccgtttgcactgaaatatgccaatctgaagcaggagacggag
ctgtttgatcaggttgtgcttcaggagtcattgatgagaaagcatacgaaggatgcaaaa
accggacttttttatcacgcctgggatgaagcgaaaaaaatgccttgggccaatgaagag
acaggctgttcaccggaattttgggcacgttccatcggctggtacgtcatgtctcttgct
gacatgattgaagagctgccgaagaagcatccgaaccgtcatgtgtggaaaaacacgctg
caggacatgattaaaagcatctgtcgctatcaagacaaagagacggggttatggtaccag
atcgttgataagggagacaggtctgataactggctggaaagctcaggatcctgtctgtac
atgtacgcaatcgcaaaaggaatcaataaaggctatctagacagagcttacgaaacaaca
ctgctaaaagcgtatcaaggcttgattcagcataaaaccgaaacatcagaagacggagcg
tttctcgtcaaagacatatgtgtcggaacgtcagccggtttctatgactattatgtcagc
cgcgaaagaagcacaaacgatctgcacggagccggcgcgtttattttagctatgacagag
ctggagcctctttttaggtcagcggggaaatga

DBGET integrated database retrieval system