KEGG   Bacillus subtilis subsp. subtilis 168: BSU30135
Entry
BSU30135          CDS       T00010                                 

Symbol
yteP
Name
(RefSeq) multiple-sugar transport system permease YteP
  KO
K17319  putative aldouronate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30135 (yteP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30135 (yteP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    BSU30135 (yteP)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 937271
NCBI-ProteinID: NP_390892
UniProt: C0SPB3 A0A6M4JMK3
Position
complement(3082260..3083225)
AA seq 321 aa
MKTAEAQAPAVDAVIFKKEKRKRLLIKLIQQKYLYLMILPGCIYFLLFKYVPMWGIVIAF
QDYQPFLGILGSEWVGLKHFIRLFTEPTFFLLLKNTLVLFALNLAIFFPVPILLALLLNE
VRIALFKKFVQTLIYIPHFMSWVIVVSLSFVLLTVDGGLINELIVFFGGEKINFLLNEEW
FRPLYILQVIWREAGWSTIIYLAAITAVDPQLYEAAKMDGAGRLRQMWHITLPAIKSVIV
VLLILKIGDTLELGFEHVYLLLNATNREVAEIFDTYVYTAGLKQGQFSYSTAVGVFKAAV
GLILVMLANRLAKKFGEEGIY
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaaaacagcagaagcgcaagcgccggctgttgatgcagtcatttttaaaaaagaaaaa
agaaagcgcttactaatcaagctgattcaacaaaaatatttgtacttgatgattttgccg
gggtgtatttattttttgctttttaagtatgtcccgatgtggggaattgtgattgcgttt
caggattatcagccgttcctcggcattttgggcagtgagtgggtggggctgaagcatttt
atcaggctgtttactgagcctacattttttctcttgttaaaaaacacgctcgtgttattt
gctttgaacctggccatatttttcccggtgccgatactgctggcgcttctattgaacgaa
gtgcggattgctctctttaaaaaatttgttcagacgctgatttatatcccgcattttatg
tcttgggtcattgttgtatcgctttcgtttgtgcttttaacggtagacggaggcttgatt
aatgaactgattgtgttttttggcggtgaaaaaatcaattttctgctgaacgaagaatgg
ttccggcccctgtatattctgcaggttatctggagggaagcgggctggtcgacgatcatt
tatctggcggccattacagcggttgacccccagctgtatgaagcggcgaaaatggacgga
gcgggacggctgcggcaaatgtggcatattacgctgcccgccattaaaagcgttatcgtc
gttttgctgattttgaaaatcggagacacgctggagcttggcttcgagcatgtgtatttg
ctgttaaatgcgactaacagggaagtggcggaaatttttgatacgtatgtttatactgca
gggctgaaacagggccaattcagctacagtacagcagtcggcgtatttaaagcggcggtc
gggctgattttggtcatgctagcgaatcgtttggcgaagaaatttggcgaggaaggaatt
tattag

DBGET integrated database retrieval system