KEGG   Bacillus subtilis subsp. subtilis 168: BSU30160
Entry
BSU30160          CDS       T00010                                 

Symbol
ytcQ
Name
(RefSeq) peptide ABC transporter substrate-binding protein
  KO
K17318  putative aldouronate transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30160 (ytcQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30160 (ytcQ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    BSU30160 (ytcQ)
SSDB
Motif
Pfam: SBP_bac_8 SBP_bac_1
Other DBs
NCBI-GeneID: 938090
NCBI-ProteinID: NP_390894
Pasteur: BG13836
BSORF: BG13836
UniProt: Q795R2 A0A6M4JN58
Position
complement(3085800..3087296)
AA seq 498 aa
MGNKWRVLLIVLVLALGGVLAGCKGTDQSSAEGKAGPDSKVKLSWMAILYHQQPPKDRAI
KEIEKLTNTELDITWVPDAVKEDRLNAALAAGNLPQIVTIQDIKNSSVMNAFRSGMFWEI
GDYIKDYPNLNKMNKLINKNVTIDGKLYGIYRERPLSRQGIVIRKDWLDNLNLKTPKTLD
ELYEVAKAFTEDDPDKDGKDDTFGLADRNDLIYGAFKTIGSYEGMPTDWKESGGKFTPDF
MTQEYKDTMNYMKKLRDNGYMNKDFPVTSKTQQQELFSQGKAGIYIGNMVDAVNLRDHAS
DKSMKLEIINRIKGPDGKERVWASGGHNGVFAFPKTSVKTEAELKRILAFFDRIAEEDVY
SLMTYGIDGVHYNKGEDKTFTRKESQVKDWQTDIQPLSALIAIDKAYLKNTGDPLRTAYE
ELTEDNEKIIVSNPAESLYSASESERGDELKKIIDDATYKYMIGDITESQFDKEVEKWES
SGGKQIIQEYEEAFKQAK
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgggaaacaaatggagggtgcttttgattgtgcttgtactggcactcggcggagtgctg
gcgggctgtaaaggaactgatcagtcttcggctgaaggcaaagctggcccagattcaaag
gtaaagctgtcttggatggcgattttgtatcaccagcagccgccgaaagacagggcgatt
aaagaaattgaaaagctgacaaatacagaactcgacatcacctgggttccagacgcggtg
aaagaagacaggctgaatgcagcgcttgcagccggcaatcttccgcaaatcgtgaccatc
caggatattaaaaattcgtcagtcatgaatgcctttcggtcaggaatgttttgggaaatc
ggcgattatatcaaggattatcccaacttaaacaaaatgaacaaactcattaataaaaat
gtgacaattgacggcaagctctacgggatatacagagagcgcccgctttccagacagggg
atcgtcattcggaaggactggctggacaatttaaatttgaaaaccccgaaaacgttggat
gagctttatgaagtggccaaagcatttacggaggacgacccggacaaggatgggaaagat
gatacattcgggctggcagaccgtaatgacttgatttacggcgcgtttaaaacgattggc
tcgtatgaaggcatgccgacagattggaaggaatcgggcggcaaattcacgcctgatttc
atgacacaggaatacaaagacacgatgaactatatgaaaaagctgcgtgataacgggtat
atgaataaggattttcccgtcacaagcaaaacccagcagcaagagctgttttctcaagga
aaagccggaatttatattggcaatatggtagatgcggtcaatctgcgcgaccatgcctct
gataaatcgatgaagctcgagatcatcaaccgcataaaaggcccagatgggaaagagcgg
gtatgggcatcaggaggccataacggcgtgtttgctttcccgaaaacgagtgtgaaaacg
gaagctgagcttaaacggatcttggcgttttttgaccgaattgccgaagaagatgtctat
agcctgatgacttatggcattgacggcgttcattacaacaaaggtgaggacaaaacgttt
acacgcaaagaaagccaggtaaaagactggcagactgatattcagccgctgtccgcttta
attgccattgataaagcctacttaaaaaacactggagatccgcttcggacggcgtacgag
gagctgaccgaggacaatgaaaagattatcgtctcaaacccggctgaaagcctgtattcc
gcatcggagtcggaacggggtgacgaactgaagaaaatcattgatgacgcgacctacaaa
tatatgattggagacatcacagaaagccagttcgataaagaagtggaaaaatgggagtca
agcggaggaaaacaaattattcaggaatacgaagaagcgtttaaacaagcaaaataa

DBGET integrated database retrieval system