KEGG   Bacillus subtilis subsp. subtilis 168: BSU30170
Entry
BSU30170          CDS       T00010                                 

Symbol
ytcP
Name
(RefSeq) ABC transporter permease
  KO
K17320  putative aldouronate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30170 (ytcP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30170 (ytcP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative aldouronate transporter
    BSU30170 (ytcP)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 938095
NCBI-ProteinID: NP_390895
Pasteur: BG11788
BSORF: BG11788
UniProt: P53561 A0A6M4JRP5
Position
complement(3087321..3088181)
AA seq 286 aa
MKNRLFDMLIYGFLLMFALICVLPFIHVIAASFATVEEVVSKKFILIPTTFSLDAYRYIF
STDIIYKSLLVSVFVTVIGTAVSMFLSSLMAYGLSRRDLIGRQPLMFLVVFTMLFSGGMI
PTFLVVKSLGLLDSYWALILPTAINAFNLIILKNFFQNIPSSLEESAKIDGCNDLGIFFK
IVLPLSLPAIATISLFYAVTYWNTYMTAILYLNDSAKWPIQVLLRQIVIVSSGMQGDMSE
MGSGSPPPEQTIKMAVIVVATIPVLLVYPFIQKHFAKGALLGSVKG
NT seq 861 nt   +upstreamnt  +downstreamnt
ctgaaaaaccgtctgtttgatatgttgatttatggtttcttgctgatgttcgctttaata
tgcgtacttccgttcattcatgttatcgcagcatcctttgccacagtagaagaagtcgtg
tcgaaaaaatttattttaataccgaccactttttcgctagatgcttatcgctacattttt
tcaacagatattatttataagagtttgcttgtttctgtgtttgtgacagtgataggcact
gcggtcagcatgtttctttcgtcactgatggcttacgggttatcccgccgtgatttaatc
ggccggcagccgctcatgtttctcgtcgtatttacgatgctgtttagcggcggcatgatt
ccgactttccttgtggtcaaatcgcttggattgctcgattcttactgggcgcttattttg
ccgacagccattaatgcctttaacctgatcattctgaaaaacttctttcaaaatatcccg
tcaagcctggaagagtccgcgaaaattgacgggtgcaatgatctgggcatattctttaaa
attgtgctgccgctgtctcttcctgcgatcgcaacgatttcactattttatgcggtcacg
tattggaacacgtatatgacagcgatcttgtacttaaatgattcagcaaaatggccaatt
caggtgcttctgcgccaaatcgtcattgtatcaagcggtatgcagggggatatgtctgaa
atggggtcgggcagcccgccgcctgagcaaaccattaaaatggcggtcatagtggtggcg
accatccctgttctgcttgtctatccgtttatacaaaagcattttgcaaaaggagctttg
ctgggatctgtcaaaggataa

DBGET integrated database retrieval system